KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135988
Entry
101135988         CDS       T02442                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo01522  Endocrine resistance
ggo01524  Platinum drug resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04140  Autophagy - animal
ggo04148  Efferocytosis
ggo04150  mTOR signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04210  Apoptosis
ggo04218  Cellular senescence
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04350  TGF-beta signaling pathway
ggo04360  Axon guidance
ggo04370  VEGF signaling pathway
ggo04371  Apelin signaling pathway
ggo04380  Osteoclast differentiation
ggo04510  Focal adhesion
ggo04520  Adherens junction
ggo04540  Gap junction
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04613  Neutrophil extracellular trap formation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04650  Natural killer cell mediated cytotoxicity
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04662  B cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04668  TNF signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04810  Regulation of actin cytoskeleton
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04917  Prolactin signaling pathway
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04930  Type II diabetes mellitus
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04960  Aldosterone-regulated sodium reabsorption
ggo05010  Alzheimer disease
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05034  Alcoholism
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05164  Influenza A
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05207  Chemical carcinogenesis - receptor activation
ggo05208  Chemical carcinogenesis - reactive oxygen species
ggo05210  Colorectal cancer
ggo05211  Renal cell carcinoma
ggo05212  Pancreatic cancer
ggo05213  Endometrial cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05216  Thyroid cancer
ggo05218  Melanoma
ggo05219  Bladder cancer
ggo05220  Chronic myeloid leukemia
ggo05221  Acute myeloid leukemia
ggo05223  Non-small cell lung cancer
ggo05224  Breast cancer
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
ggo05230  Central carbon metabolism in cancer
ggo05231  Choline metabolism in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101135988 (MAPK3)
   04012 ErbB signaling pathway
    101135988 (MAPK3)
   04014 Ras signaling pathway
    101135988 (MAPK3)
   04015 Rap1 signaling pathway
    101135988 (MAPK3)
   04350 TGF-beta signaling pathway
    101135988 (MAPK3)
   04370 VEGF signaling pathway
    101135988 (MAPK3)
   04371 Apelin signaling pathway
    101135988 (MAPK3)
   04668 TNF signaling pathway
    101135988 (MAPK3)
   04066 HIF-1 signaling pathway
    101135988 (MAPK3)
   04068 FoxO signaling pathway
    101135988 (MAPK3)
   04072 Phospholipase D signaling pathway
    101135988 (MAPK3)
   04071 Sphingolipid signaling pathway
    101135988 (MAPK3)
   04024 cAMP signaling pathway
    101135988 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101135988 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101135988 (MAPK3)
   04150 mTOR signaling pathway
    101135988 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101135988 (MAPK3)
   04148 Efferocytosis
    101135988 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101135988 (MAPK3)
   04210 Apoptosis
    101135988 (MAPK3)
   04218 Cellular senescence
    101135988 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101135988 (MAPK3)
   04520 Adherens junction
    101135988 (MAPK3)
   04540 Gap junction
    101135988 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101135988 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101135988 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101135988 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101135988 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101135988 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101135988 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101135988 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101135988 (MAPK3)
   04660 T cell receptor signaling pathway
    101135988 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101135988 (MAPK3)
   04659 Th17 cell differentiation
    101135988 (MAPK3)
   04657 IL-17 signaling pathway
    101135988 (MAPK3)
   04662 B cell receptor signaling pathway
    101135988 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101135988 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101135988 (MAPK3)
   04062 Chemokine signaling pathway
    101135988 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101135988 (MAPK3)
   04929 GnRH secretion
    101135988 (MAPK3)
   04912 GnRH signaling pathway
    101135988 (MAPK3)
   04915 Estrogen signaling pathway
    101135988 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101135988 (MAPK3)
   04917 Prolactin signaling pathway
    101135988 (MAPK3)
   04921 Oxytocin signaling pathway
    101135988 (MAPK3)
   04926 Relaxin signaling pathway
    101135988 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101135988 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101135988 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101135988 (MAPK3)
   04916 Melanogenesis
    101135988 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101135988 (MAPK3)
   04270 Vascular smooth muscle contraction
    101135988 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101135988 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101135988 (MAPK3)
   04725 Cholinergic synapse
    101135988 (MAPK3)
   04726 Serotonergic synapse
    101135988 (MAPK3)
   04720 Long-term potentiation
    101135988 (MAPK3)
   04730 Long-term depression
    101135988 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101135988 (MAPK3)
   04722 Neurotrophin signaling pathway
    101135988 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101135988 (MAPK3)
   04380 Osteoclast differentiation
    101135988 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101135988 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101135988 (MAPK3)
   05206 MicroRNAs in cancer
    101135988 (MAPK3)
   05205 Proteoglycans in cancer
    101135988 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101135988 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101135988 (MAPK3)
   05203 Viral carcinogenesis
    101135988 (MAPK3)
   05230 Central carbon metabolism in cancer
    101135988 (MAPK3)
   05231 Choline metabolism in cancer
    101135988 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101135988 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101135988 (MAPK3)
   05212 Pancreatic cancer
    101135988 (MAPK3)
   05225 Hepatocellular carcinoma
    101135988 (MAPK3)
   05226 Gastric cancer
    101135988 (MAPK3)
   05214 Glioma
    101135988 (MAPK3)
   05216 Thyroid cancer
    101135988 (MAPK3)
   05221 Acute myeloid leukemia
    101135988 (MAPK3)
   05220 Chronic myeloid leukemia
    101135988 (MAPK3)
   05218 Melanoma
    101135988 (MAPK3)
   05211 Renal cell carcinoma
    101135988 (MAPK3)
   05219 Bladder cancer
    101135988 (MAPK3)
   05215 Prostate cancer
    101135988 (MAPK3)
   05213 Endometrial cancer
    101135988 (MAPK3)
   05224 Breast cancer
    101135988 (MAPK3)
   05223 Non-small cell lung cancer
    101135988 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101135988 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101135988 (MAPK3)
   05161 Hepatitis B
    101135988 (MAPK3)
   05160 Hepatitis C
    101135988 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101135988 (MAPK3)
   05164 Influenza A
    101135988 (MAPK3)
   05163 Human cytomegalovirus infection
    101135988 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101135988 (MAPK3)
   05165 Human papillomavirus infection
    101135988 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101135988 (MAPK3)
   05135 Yersinia infection
    101135988 (MAPK3)
   05133 Pertussis
    101135988 (MAPK3)
   05152 Tuberculosis
    101135988 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101135988 (MAPK3)
   05140 Leishmaniasis
    101135988 (MAPK3)
   05142 Chagas disease
    101135988 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101135988 (MAPK3)
   05020 Prion disease
    101135988 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101135988 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101135988 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101135988 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101135988 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101135988 (MAPK3)
   04934 Cushing syndrome
    101135988 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101135988 (MAPK3)
   01524 Platinum drug resistance
    101135988 (MAPK3)
   01522 Endocrine resistance
    101135988 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101135988 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ggo03036]
    101135988 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101135988 (MAPK3)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101135988 (MAPK3)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101135988 (MAPK3)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101135988 (MAPK3)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101135988 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 101135988
NCBI-ProteinID: XP_030862983
Ensembl: ENSGGOG00000008951
LinkDB
Position
18:complement(join(32052961..32053083,32053187..32053296,32053447..32053578,32053963..32054077,32054340..32054456,32054642..32054831,32058104..32058286,32059330..32059502))
AA seq 380 aa
MAAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKER
LKELIFQETARFQPGVLEAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccgtagaaccgagggg
gtcggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggc
ccgcgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagctcggcc
tatgaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgaacatcag
acctactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaat
gtcatcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtctac
attgtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctgagc
aatgaccatatctgctacttcctctaccagatcctgcggggcctcaagtacatccactcc
gccaacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatttgtgatttcggcctggcccggattgccgatcctgagcatgaccacactggc
ttcctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaactcc
aagggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tctaaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggc
atcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtca
gactccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatc
acagtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgag
ccagtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcgg
ctgaaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggccccc
tag

DBGET integrated database retrieval system