Entry |
|
Symbol |
MAPK3
|
Name |
(RefSeq) mitogen-activated protein kinase 3
|
KO |
|
Organism |
ggo Gorilla gorilla gorilla (western lowland gorilla)
|
Pathway |
ggo01521 | EGFR tyrosine kinase inhibitor resistance |
ggo04072 | Phospholipase D signaling pathway |
ggo04261 | Adrenergic signaling in cardiomyocytes |
ggo04270 | Vascular smooth muscle contraction |
ggo04550 | Signaling pathways regulating pluripotency of stem cells |
ggo04613 | Neutrophil extracellular trap formation |
ggo04620 | Toll-like receptor signaling pathway |
ggo04621 | NOD-like receptor signaling pathway |
ggo04625 | C-type lectin receptor signaling pathway |
ggo04650 | Natural killer cell mediated cytotoxicity |
ggo04658 | Th1 and Th2 cell differentiation |
ggo04660 | T cell receptor signaling pathway |
ggo04662 | B cell receptor signaling pathway |
ggo04664 | Fc epsilon RI signaling pathway |
ggo04666 | Fc gamma R-mediated phagocytosis |
ggo04723 | Retrograde endocannabinoid signaling |
ggo04810 | Regulation of actin cytoskeleton |
ggo04914 | Progesterone-mediated oocyte maturation |
ggo04919 | Thyroid hormone signaling pathway |
ggo04928 | Parathyroid hormone synthesis, secretion and action |
ggo04933 | AGE-RAGE signaling pathway in diabetic complications |
ggo04935 | Growth hormone synthesis, secretion and action |
ggo04960 | Aldosterone-regulated sodium reabsorption |
ggo05022 | Pathways of neurodegeneration - multiple diseases |
ggo05163 | Human cytomegalovirus infection |
ggo05166 | Human T-cell leukemia virus 1 infection |
ggo05167 | Kaposi sarcoma-associated herpesvirus infection |
ggo05170 | Human immunodeficiency virus 1 infection |
ggo05207 | Chemical carcinogenesis - receptor activation |
ggo05208 | Chemical carcinogenesis - reactive oxygen species |
ggo05230 | Central carbon metabolism in cancer |
ggo05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
|
Brite |
KEGG Orthology (KO) [BR:ggo00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
101135988 (MAPK3)
04012 ErbB signaling pathway
101135988 (MAPK3)
04014 Ras signaling pathway
101135988 (MAPK3)
04015 Rap1 signaling pathway
101135988 (MAPK3)
04350 TGF-beta signaling pathway
101135988 (MAPK3)
04370 VEGF signaling pathway
101135988 (MAPK3)
04371 Apelin signaling pathway
101135988 (MAPK3)
04668 TNF signaling pathway
101135988 (MAPK3)
04066 HIF-1 signaling pathway
101135988 (MAPK3)
04068 FoxO signaling pathway
101135988 (MAPK3)
04072 Phospholipase D signaling pathway
101135988 (MAPK3)
04071 Sphingolipid signaling pathway
101135988 (MAPK3)
04024 cAMP signaling pathway
101135988 (MAPK3)
04022 cGMP-PKG signaling pathway
101135988 (MAPK3)
04151 PI3K-Akt signaling pathway
101135988 (MAPK3)
04150 mTOR signaling pathway
101135988 (MAPK3)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
101135988 (MAPK3)
04148 Efferocytosis
101135988 (MAPK3)
09143 Cell growth and death
04114 Oocyte meiosis
101135988 (MAPK3)
04210 Apoptosis
101135988 (MAPK3)
04218 Cellular senescence
101135988 (MAPK3)
09144 Cellular community - eukaryotes
04510 Focal adhesion
101135988 (MAPK3)
04520 Adherens junction
101135988 (MAPK3)
04540 Gap junction
101135988 (MAPK3)
04550 Signaling pathways regulating pluripotency of stem cells
101135988 (MAPK3)
09142 Cell motility
04810 Regulation of actin cytoskeleton
101135988 (MAPK3)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
101135988 (MAPK3)
04613 Neutrophil extracellular trap formation
101135988 (MAPK3)
04620 Toll-like receptor signaling pathway
101135988 (MAPK3)
04621 NOD-like receptor signaling pathway
101135988 (MAPK3)
04625 C-type lectin receptor signaling pathway
101135988 (MAPK3)
04650 Natural killer cell mediated cytotoxicity
101135988 (MAPK3)
04660 T cell receptor signaling pathway
101135988 (MAPK3)
04658 Th1 and Th2 cell differentiation
101135988 (MAPK3)
04659 Th17 cell differentiation
101135988 (MAPK3)
04657 IL-17 signaling pathway
101135988 (MAPK3)
04662 B cell receptor signaling pathway
101135988 (MAPK3)
04664 Fc epsilon RI signaling pathway
101135988 (MAPK3)
04666 Fc gamma R-mediated phagocytosis
101135988 (MAPK3)
04062 Chemokine signaling pathway
101135988 (MAPK3)
09152 Endocrine system
04910 Insulin signaling pathway
101135988 (MAPK3)
04929 GnRH secretion
101135988 (MAPK3)
04912 GnRH signaling pathway
101135988 (MAPK3)
04915 Estrogen signaling pathway
101135988 (MAPK3)
04914 Progesterone-mediated oocyte maturation
101135988 (MAPK3)
04917 Prolactin signaling pathway
101135988 (MAPK3)
04921 Oxytocin signaling pathway
101135988 (MAPK3)
04926 Relaxin signaling pathway
101135988 (MAPK3)
04935 Growth hormone synthesis, secretion and action
101135988 (MAPK3)
04919 Thyroid hormone signaling pathway
101135988 (MAPK3)
04928 Parathyroid hormone synthesis, secretion and action
101135988 (MAPK3)
04916 Melanogenesis
101135988 (MAPK3)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
101135988 (MAPK3)
04270 Vascular smooth muscle contraction
101135988 (MAPK3)
09155 Excretory system
04960 Aldosterone-regulated sodium reabsorption
101135988 (MAPK3)
09156 Nervous system
04724 Glutamatergic synapse
101135988 (MAPK3)
04725 Cholinergic synapse
101135988 (MAPK3)
04726 Serotonergic synapse
101135988 (MAPK3)
04720 Long-term potentiation
101135988 (MAPK3)
04730 Long-term depression
101135988 (MAPK3)
04723 Retrograde endocannabinoid signaling
101135988 (MAPK3)
04722 Neurotrophin signaling pathway
101135988 (MAPK3)
09158 Development and regeneration
04360 Axon guidance
101135988 (MAPK3)
04380 Osteoclast differentiation
101135988 (MAPK3)
09159 Environmental adaptation
04713 Circadian entrainment
101135988 (MAPK3)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101135988 (MAPK3)
05206 MicroRNAs in cancer
101135988 (MAPK3)
05205 Proteoglycans in cancer
101135988 (MAPK3)
05207 Chemical carcinogenesis - receptor activation
101135988 (MAPK3)
05208 Chemical carcinogenesis - reactive oxygen species
101135988 (MAPK3)
05203 Viral carcinogenesis
101135988 (MAPK3)
05230 Central carbon metabolism in cancer
101135988 (MAPK3)
05231 Choline metabolism in cancer
101135988 (MAPK3)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
101135988 (MAPK3)
09162 Cancer: specific types
05210 Colorectal cancer
101135988 (MAPK3)
05212 Pancreatic cancer
101135988 (MAPK3)
05225 Hepatocellular carcinoma
101135988 (MAPK3)
05226 Gastric cancer
101135988 (MAPK3)
05214 Glioma
101135988 (MAPK3)
05216 Thyroid cancer
101135988 (MAPK3)
05221 Acute myeloid leukemia
101135988 (MAPK3)
05220 Chronic myeloid leukemia
101135988 (MAPK3)
05218 Melanoma
101135988 (MAPK3)
05211 Renal cell carcinoma
101135988 (MAPK3)
05219 Bladder cancer
101135988 (MAPK3)
05215 Prostate cancer
101135988 (MAPK3)
05213 Endometrial cancer
101135988 (MAPK3)
05224 Breast cancer
101135988 (MAPK3)
05223 Non-small cell lung cancer
101135988 (MAPK3)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
101135988 (MAPK3)
05170 Human immunodeficiency virus 1 infection
101135988 (MAPK3)
05161 Hepatitis B
101135988 (MAPK3)
05160 Hepatitis C
101135988 (MAPK3)
05171 Coronavirus disease - COVID-19
101135988 (MAPK3)
05164 Influenza A
101135988 (MAPK3)
05163 Human cytomegalovirus infection
101135988 (MAPK3)
05167 Kaposi sarcoma-associated herpesvirus infection
101135988 (MAPK3)
05165 Human papillomavirus infection
101135988 (MAPK3)
09171 Infectious disease: bacterial
05132 Salmonella infection
101135988 (MAPK3)
05135 Yersinia infection
101135988 (MAPK3)
05133 Pertussis
101135988 (MAPK3)
05152 Tuberculosis
101135988 (MAPK3)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
101135988 (MAPK3)
05140 Leishmaniasis
101135988 (MAPK3)
05142 Chagas disease
101135988 (MAPK3)
09164 Neurodegenerative disease
05010 Alzheimer disease
101135988 (MAPK3)
05020 Prion disease
101135988 (MAPK3)
05022 Pathways of neurodegeneration - multiple diseases
101135988 (MAPK3)
09165 Substance dependence
05034 Alcoholism
101135988 (MAPK3)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
101135988 (MAPK3)
09167 Endocrine and metabolic disease
04930 Type II diabetes mellitus
101135988 (MAPK3)
04933 AGE-RAGE signaling pathway in diabetic complications
101135988 (MAPK3)
04934 Cushing syndrome
101135988 (MAPK3)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
101135988 (MAPK3)
01524 Platinum drug resistance
101135988 (MAPK3)
01522 Endocrine resistance
101135988 (MAPK3)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:ggo01001]
101135988 (MAPK3)
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:ggo03036]
101135988 (MAPK3)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:ggo04147]
101135988 (MAPK3)
Enzymes [BR:ggo01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
101135988 (MAPK3)
Protein kinases [BR:ggo01001]
Serine/threonine kinases: CMGC group
MAPK family [OT]
101135988 (MAPK3)
Chromosome and associated proteins [BR:ggo03036]
Eukaryotic type
Centromeric chromatin formation proteins
SAC (spindle assembly checkpoint) factors
Protein kinases
101135988 (MAPK3)
Exosome [BR:ggo04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
101135988 (MAPK3)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
18:complement(join(32052961..32053083,32053187..32053296,32053447..32053578,32053963..32054077,32054340..32054456,32054642..32054831,32058104..32058286,32059330..32059502))
|
AA seq |
380 aa
MAAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKER
LKELIFQETARFQPGVLEAP |
NT seq |
1143 nt +upstreamnt +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccgtagaaccgagggg
gtcggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggc
ccgcgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagctcggcc
tatgaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgaacatcag
acctactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaat
gtcatcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtctac
attgtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctgagc
aatgaccatatctgctacttcctctaccagatcctgcggggcctcaagtacatccactcc
gccaacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatttgtgatttcggcctggcccggattgccgatcctgagcatgaccacactggc
ttcctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaactcc
aagggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tctaaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggc
atcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtca
gactccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatc
acagtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgag
ccagtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcgg
ctgaaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggccccc
tag |