KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136425
Entry
101136425         CDS       T02442                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04062  Chemokine signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04137  Mitophagy - animal
ggo04140  Autophagy - animal
ggo04144  Endocytosis
ggo04150  mTOR signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04210  Apoptosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04218  Cellular senescence
ggo04360  Axon guidance
ggo04370  VEGF signaling pathway
ggo04371  Apelin signaling pathway
ggo04510  Focal adhesion
ggo04540  Gap junction
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04625  C-type lectin receptor signaling pathway
ggo04630  JAK-STAT signaling pathway
ggo04650  Natural killer cell mediated cytotoxicity
ggo04660  T cell receptor signaling pathway
ggo04662  B cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04714  Thermogenesis
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04810  Regulation of actin cytoskeleton
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04917  Prolactin signaling pathway
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04929  GnRH secretion
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05010  Alzheimer disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05034  Alcoholism
ggo05132  Salmonella infection
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05207  Chemical carcinogenesis - receptor activation
ggo05208  Chemical carcinogenesis - reactive oxygen species
ggo05210  Colorectal cancer
ggo05211  Renal cell carcinoma
ggo05213  Endometrial cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05216  Thyroid cancer
ggo05218  Melanoma
ggo05219  Bladder cancer
ggo05220  Chronic myeloid leukemia
ggo05221  Acute myeloid leukemia
ggo05223  Non-small cell lung cancer
ggo05224  Breast cancer
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
ggo05230  Central carbon metabolism in cancer
ggo05231  Choline metabolism in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101136425 (HRAS)
   04012 ErbB signaling pathway
    101136425 (HRAS)
   04014 Ras signaling pathway
    101136425 (HRAS)
   04015 Rap1 signaling pathway
    101136425 (HRAS)
   04370 VEGF signaling pathway
    101136425 (HRAS)
   04371 Apelin signaling pathway
    101136425 (HRAS)
   04630 JAK-STAT signaling pathway
    101136425 (HRAS)
   04068 FoxO signaling pathway
    101136425 (HRAS)
   04072 Phospholipase D signaling pathway
    101136425 (HRAS)
   04071 Sphingolipid signaling pathway
    101136425 (HRAS)
   04151 PI3K-Akt signaling pathway
    101136425 (HRAS)
   04150 mTOR signaling pathway
    101136425 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101136425 (HRAS)
   04140 Autophagy - animal
    101136425 (HRAS)
   04137 Mitophagy - animal
    101136425 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101136425 (HRAS)
   04218 Cellular senescence
    101136425 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101136425 (HRAS)
   04540 Gap junction
    101136425 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101136425 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101136425 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101136425 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    101136425 (HRAS)
   04660 T cell receptor signaling pathway
    101136425 (HRAS)
   04662 B cell receptor signaling pathway
    101136425 (HRAS)
   04664 Fc epsilon RI signaling pathway
    101136425 (HRAS)
   04062 Chemokine signaling pathway
    101136425 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101136425 (HRAS)
   04929 GnRH secretion
    101136425 (HRAS)
   04912 GnRH signaling pathway
    101136425 (HRAS)
   04915 Estrogen signaling pathway
    101136425 (HRAS)
   04917 Prolactin signaling pathway
    101136425 (HRAS)
   04921 Oxytocin signaling pathway
    101136425 (HRAS)
   04926 Relaxin signaling pathway
    101136425 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    101136425 (HRAS)
   04919 Thyroid hormone signaling pathway
    101136425 (HRAS)
   04916 Melanogenesis
    101136425 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101136425 (HRAS)
   04726 Serotonergic synapse
    101136425 (HRAS)
   04720 Long-term potentiation
    101136425 (HRAS)
   04730 Long-term depression
    101136425 (HRAS)
   04722 Neurotrophin signaling pathway
    101136425 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101136425 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101136425 (HRAS)
   04213 Longevity regulating pathway - multiple species
    101136425 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101136425 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101136425 (HRAS)
   05206 MicroRNAs in cancer
    101136425 (HRAS)
   05205 Proteoglycans in cancer
    101136425 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    101136425 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    101136425 (HRAS)
   05203 Viral carcinogenesis
    101136425 (HRAS)
   05230 Central carbon metabolism in cancer
    101136425 (HRAS)
   05231 Choline metabolism in cancer
    101136425 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101136425 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101136425 (HRAS)
   05225 Hepatocellular carcinoma
    101136425 (HRAS)
   05226 Gastric cancer
    101136425 (HRAS)
   05214 Glioma
    101136425 (HRAS)
   05216 Thyroid cancer
    101136425 (HRAS)
   05221 Acute myeloid leukemia
    101136425 (HRAS)
   05220 Chronic myeloid leukemia
    101136425 (HRAS)
   05218 Melanoma
    101136425 (HRAS)
   05211 Renal cell carcinoma
    101136425 (HRAS)
   05219 Bladder cancer
    101136425 (HRAS)
   05215 Prostate cancer
    101136425 (HRAS)
   05213 Endometrial cancer
    101136425 (HRAS)
   05224 Breast cancer
    101136425 (HRAS)
   05223 Non-small cell lung cancer
    101136425 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101136425 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    101136425 (HRAS)
   05161 Hepatitis B
    101136425 (HRAS)
   05160 Hepatitis C
    101136425 (HRAS)
   05163 Human cytomegalovirus infection
    101136425 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101136425 (HRAS)
   05165 Human papillomavirus infection
    101136425 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101136425 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101136425 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101136425 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    101136425 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101136425 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101136425 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101136425 (HRAS)
   01522 Endocrine resistance
    101136425 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101136425 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101136425 (HRAS)
   04031 GTP-binding proteins [BR:ggo04031]
    101136425 (HRAS)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    101136425 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101136425 (HRAS)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101136425 (HRAS)
  Exosomal proteins of colorectal cancer cells
   101136425 (HRAS)
GTP-binding proteins [BR:ggo04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101136425 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N DUF6974 Sua5_yciO_yrdC
Other DBs
NCBI-GeneID: 101136425
NCBI-ProteinID: XP_004050407
Ensembl: ENSGGOG00000015438
UniProt: A0A2I2YWA2
LinkDB
Position
9:complement(join(6978666..6978785,6979480..6979639,6979793..6979971,6980241..6980351))
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AVRTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG
CMSCKCVLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggaatataagctggtggtggtgggcgccggcggtgtgggcaagagtgcgctgacc
atccagctgatccagaaccactttgtggacgaatacgaccccactatagaggattcctac
cggaagcaggtggtcattgatggggagacatgcctgttggatatcctggacacggccggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctgtgt
gtgtttgccatcaacaacaccaagtcttttgaggacatccaccagtacagggagcagatc
aaacgggtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgacctg
gctgtacgcactgtggaatctcggcaggctcaggacctcgcccgaagctacggcatcccc
tacatcgagacgtcggccaagacccggcagggagtggaggatgccttctacacgttggtg
cgtgagatccggcagcacaagctgcggaagctgaaccctcctgatgagagtggccccggc
tgcatgagctgcaagtgtgtgctctcctga

DBGET integrated database retrieval system