KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151027
Entry
101151027         CDS       T02442                                 
Symbol
TP53AIP1
Name
(RefSeq) p53-regulated apoptosis-inducing protein 1 isoform X1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04115  p53 signaling pathway
ggo04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101151027 (TP53AIP1)
   04115 p53 signaling pathway
    101151027 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 101151027
NCBI-ProteinID: XP_004052477
Ensembl: ENSGGOG00000015993
UniProt: G3RIT2
LinkDB
Position
11:complement(112077392..112086061)
AA seq 124 aa
MGSSPKVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDLLVLGAQVHG
GCRGIEALSVSSGSWSSVTVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAP
LRLQ
NT seq 375 nt   +upstreamnt  +downstreamnt
atggggtcttcccctaaggtgagcttcagatctgctcaagcttcctgcagtggggccagg
aggcagggcctgggcaggggagaccagaacctctcggtgatgcctccgaatggcagggct
cagacacacacaccgggctgggtttcagatctcttagttttgggtgcccaagttcacgga
gggtgccggggaatagaagctctgtcagtctcgtctggatcttggtcctcagtaactgtc
tggatcctgacaggccttggtctgggtctctccaggcctttccttcctggagccacagtg
cttagagacaggccactggggtcagcatttgagctcagctacgatcagaaaaaagcaccg
ttgaggttgcagtga

DBGET integrated database retrieval system