Entry |
|
Symbol |
MAPK9
|
Name |
(RefSeq) mitogen-activated protein kinase 9 isoform X4
|
KO |
K04440 | mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] |
|
Organism |
ggo Gorilla gorilla gorilla (western lowland gorilla)
|
Pathway |
ggo04141 | Protein processing in endoplasmic reticulum |
ggo04620 | Toll-like receptor signaling pathway |
ggo04621 | NOD-like receptor signaling pathway |
ggo04622 | RIG-I-like receptor signaling pathway |
ggo04625 | C-type lectin receptor signaling pathway |
ggo04658 | Th1 and Th2 cell differentiation |
ggo04660 | T cell receptor signaling pathway |
ggo04664 | Fc epsilon RI signaling pathway |
ggo04723 | Retrograde endocannabinoid signaling |
ggo04750 | Inflammatory mediator regulation of TRP channels |
ggo04914 | Progesterone-mediated oocyte maturation |
ggo04920 | Adipocytokine signaling pathway |
ggo04932 | Non-alcoholic fatty liver disease |
ggo04933 | AGE-RAGE signaling pathway in diabetic complications |
ggo04935 | Growth hormone synthesis, secretion and action |
ggo05022 | Pathways of neurodegeneration - multiple diseases |
ggo05166 | Human T-cell leukemia virus 1 infection |
ggo05167 | Kaposi sarcoma-associated herpesvirus infection |
ggo05170 | Human immunodeficiency virus 1 infection |
ggo05208 | Chemical carcinogenesis - reactive oxygen species |
ggo05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:ggo00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
101152026 (MAPK9)
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
101152026 (MAPK9)
04012 ErbB signaling pathway
101152026 (MAPK9)
04014 Ras signaling pathway
101152026 (MAPK9)
04310 Wnt signaling pathway
101152026 (MAPK9)
04668 TNF signaling pathway
101152026 (MAPK9)
04068 FoxO signaling pathway
101152026 (MAPK9)
04071 Sphingolipid signaling pathway
101152026 (MAPK9)
04024 cAMP signaling pathway
101152026 (MAPK9)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
101152026 (MAPK9)
04137 Mitophagy - animal
101152026 (MAPK9)
09143 Cell growth and death
04210 Apoptosis
101152026 (MAPK9)
04215 Apoptosis - multiple species
101152026 (MAPK9)
04217 Necroptosis
101152026 (MAPK9)
09144 Cellular community - eukaryotes
04510 Focal adhesion
101152026 (MAPK9)
04530 Tight junction
101152026 (MAPK9)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
101152026 (MAPK9)
04621 NOD-like receptor signaling pathway
101152026 (MAPK9)
04622 RIG-I-like receptor signaling pathway
101152026 (MAPK9)
04625 C-type lectin receptor signaling pathway
101152026 (MAPK9)
04660 T cell receptor signaling pathway
101152026 (MAPK9)
04658 Th1 and Th2 cell differentiation
101152026 (MAPK9)
04659 Th17 cell differentiation
101152026 (MAPK9)
04657 IL-17 signaling pathway
101152026 (MAPK9)
04664 Fc epsilon RI signaling pathway
101152026 (MAPK9)
09152 Endocrine system
04910 Insulin signaling pathway
101152026 (MAPK9)
04920 Adipocytokine signaling pathway
101152026 (MAPK9)
04912 GnRH signaling pathway
101152026 (MAPK9)
04914 Progesterone-mediated oocyte maturation
101152026 (MAPK9)
04917 Prolactin signaling pathway
101152026 (MAPK9)
04926 Relaxin signaling pathway
101152026 (MAPK9)
04935 Growth hormone synthesis, secretion and action
101152026 (MAPK9)
09156 Nervous system
04728 Dopaminergic synapse
101152026 (MAPK9)
04723 Retrograde endocannabinoid signaling
101152026 (MAPK9)
04722 Neurotrophin signaling pathway
101152026 (MAPK9)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
101152026 (MAPK9)
09158 Development and regeneration
04380 Osteoclast differentiation
101152026 (MAPK9)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101152026 (MAPK9)
05208 Chemical carcinogenesis - reactive oxygen species
101152026 (MAPK9)
05231 Choline metabolism in cancer
101152026 (MAPK9)
09162 Cancer: specific types
05210 Colorectal cancer
101152026 (MAPK9)
05212 Pancreatic cancer
101152026 (MAPK9)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
101152026 (MAPK9)
05170 Human immunodeficiency virus 1 infection
101152026 (MAPK9)
05161 Hepatitis B
101152026 (MAPK9)
05171 Coronavirus disease - COVID-19
101152026 (MAPK9)
05162 Measles
101152026 (MAPK9)
05167 Kaposi sarcoma-associated herpesvirus infection
101152026 (MAPK9)
05169 Epstein-Barr virus infection
101152026 (MAPK9)
09171 Infectious disease: bacterial
05132 Salmonella infection
101152026 (MAPK9)
05135 Yersinia infection
101152026 (MAPK9)
05133 Pertussis
101152026 (MAPK9)
05152 Tuberculosis
101152026 (MAPK9)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
101152026 (MAPK9)
05142 Chagas disease
101152026 (MAPK9)
09164 Neurodegenerative disease
05010 Alzheimer disease
101152026 (MAPK9)
05012 Parkinson disease
101152026 (MAPK9)
05016 Huntington disease
101152026 (MAPK9)
05017 Spinocerebellar ataxia
101152026 (MAPK9)
05020 Prion disease
101152026 (MAPK9)
05022 Pathways of neurodegeneration - multiple diseases
101152026 (MAPK9)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
101152026 (MAPK9)
05418 Fluid shear stress and atherosclerosis
101152026 (MAPK9)
05415 Diabetic cardiomyopathy
101152026 (MAPK9)
09167 Endocrine and metabolic disease
04930 Type II diabetes mellitus
101152026 (MAPK9)
04936 Alcoholic liver disease
101152026 (MAPK9)
04932 Non-alcoholic fatty liver disease
101152026 (MAPK9)
04931 Insulin resistance
101152026 (MAPK9)
04933 AGE-RAGE signaling pathway in diabetic complications
101152026 (MAPK9)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
101152026 (MAPK9)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:ggo01001]
101152026 (MAPK9)
Enzymes [BR:ggo01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
101152026 (MAPK9)
Protein kinases [BR:ggo01001]
Serine/threonine kinases: CMGC group
MAPK family [OT]
101152026 (MAPK9)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
4:complement(join(184225050..184225066,184226998..184227069,184228587..184228650,184229694..184229818,184231236..184231418,184236098..184236169,184237628..184237793,184250607..184250745,184253701..184253759,184258523..184258652,184269706..184269827))
|
AA seq |
382 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSAQMQQ |
NT seq |
1149 nt +upstreamnt +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacagcgtgcactaacttc
atgatgaccccttacgtggtgacacggtactaccgggcgcccgaagtcatcctgggtatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagacgaagctctgcgtcacccatac
atcactgtttggtatgaccccgccgaagcagaagccccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagcacagatg
cagcagtaa |