| Entry |
|
| Symbol |
MAPK14
|
| Name |
(RefSeq) mitogen-activated protein kinase 14 isoform X2
|
| KO |
|
| Organism |
ggo Gorilla gorilla gorilla (western lowland gorilla)
|
| Pathway |
| ggo04261 | Adrenergic signaling in cardiomyocytes |
| ggo04550 | Signaling pathways regulating pluripotency of stem cells |
| ggo04613 | Neutrophil extracellular trap formation |
| ggo04620 | Toll-like receptor signaling pathway |
| ggo04621 | NOD-like receptor signaling pathway |
| ggo04622 | RIG-I-like receptor signaling pathway |
| ggo04625 | C-type lectin receptor signaling pathway |
| ggo04658 | Th1 and Th2 cell differentiation |
| ggo04660 | T cell receptor signaling pathway |
| ggo04664 | Fc epsilon RI signaling pathway |
| ggo04670 | Leukocyte transendothelial migration |
| ggo04723 | Retrograde endocannabinoid signaling |
| ggo04750 | Inflammatory mediator regulation of TRP channels |
| ggo04914 | Progesterone-mediated oocyte maturation |
| ggo04932 | Non-alcoholic fatty liver disease |
| ggo04933 | AGE-RAGE signaling pathway in diabetic complications |
| ggo04935 | Growth hormone synthesis, secretion and action |
| ggo05022 | Pathways of neurodegeneration - multiple diseases |
| ggo05163 | Human cytomegalovirus infection |
| ggo05167 | Kaposi sarcoma-associated herpesvirus infection |
| ggo05170 | Human immunodeficiency virus 1 infection |
| ggo05208 | Chemical carcinogenesis - reactive oxygen species |
| ggo05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
| ggo05418 | Fluid shear stress and atherosclerosis |
|
| Brite |
KEGG Orthology (KO) [BR:ggo00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
101152640 (MAPK14)
04015 Rap1 signaling pathway
101152640 (MAPK14)
04370 VEGF signaling pathway
101152640 (MAPK14)
04668 TNF signaling pathway
101152640 (MAPK14)
04068 FoxO signaling pathway
101152640 (MAPK14)
04071 Sphingolipid signaling pathway
101152640 (MAPK14)
09133 Signaling molecules and interaction
04517 IgSF CAM signaling
101152640 (MAPK14)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
101152640 (MAPK14)
09143 Cell growth and death
04114 Oocyte meiosis
101152640 (MAPK14)
04218 Cellular senescence
101152640 (MAPK14)
09144 Cellular community - eukaryotes
04550 Signaling pathways regulating pluripotency of stem cells
101152640 (MAPK14)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
101152640 (MAPK14)
04613 Neutrophil extracellular trap formation
101152640 (MAPK14)
04620 Toll-like receptor signaling pathway
101152640 (MAPK14)
04621 NOD-like receptor signaling pathway
101152640 (MAPK14)
04622 RIG-I-like receptor signaling pathway
101152640 (MAPK14)
04625 C-type lectin receptor signaling pathway
101152640 (MAPK14)
04660 T cell receptor signaling pathway
101152640 (MAPK14)
04658 Th1 and Th2 cell differentiation
101152640 (MAPK14)
04659 Th17 cell differentiation
101152640 (MAPK14)
04657 IL-17 signaling pathway
101152640 (MAPK14)
04664 Fc epsilon RI signaling pathway
101152640 (MAPK14)
04670 Leukocyte transendothelial migration
101152640 (MAPK14)
09152 Endocrine system
04912 GnRH signaling pathway
101152640 (MAPK14)
04914 Progesterone-mediated oocyte maturation
101152640 (MAPK14)
04917 Prolactin signaling pathway
101152640 (MAPK14)
04926 Relaxin signaling pathway
101152640 (MAPK14)
04935 Growth hormone synthesis, secretion and action
101152640 (MAPK14)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
101152640 (MAPK14)
09156 Nervous system
04728 Dopaminergic synapse
101152640 (MAPK14)
04723 Retrograde endocannabinoid signaling
101152640 (MAPK14)
04722 Neurotrophin signaling pathway
101152640 (MAPK14)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
101152640 (MAPK14)
09158 Development and regeneration
04380 Osteoclast differentiation
101152640 (MAPK14)
09159 Environmental adaptation
04714 Thermogenesis
101152640 (MAPK14)
09160 Human Diseases
09161 Cancer: overview
05205 Proteoglycans in cancer
101152640 (MAPK14)
05208 Chemical carcinogenesis - reactive oxygen species
101152640 (MAPK14)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
101152640 (MAPK14)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
101152640 (MAPK14)
05161 Hepatitis B
101152640 (MAPK14)
05171 Coronavirus disease - COVID-19
101152640 (MAPK14)
05163 Human cytomegalovirus infection
101152640 (MAPK14)
05167 Kaposi sarcoma-associated herpesvirus infection
101152640 (MAPK14)
05169 Epstein-Barr virus infection
101152640 (MAPK14)
09171 Infectious disease: bacterial
05132 Salmonella infection
101152640 (MAPK14)
05135 Yersinia infection
101152640 (MAPK14)
05133 Pertussis
101152640 (MAPK14)
05152 Tuberculosis
101152640 (MAPK14)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
101152640 (MAPK14)
05140 Leishmaniasis
101152640 (MAPK14)
05142 Chagas disease
101152640 (MAPK14)
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
101152640 (MAPK14)
05020 Prion disease
101152640 (MAPK14)
05022 Pathways of neurodegeneration - multiple diseases
101152640 (MAPK14)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
101152640 (MAPK14)
05418 Fluid shear stress and atherosclerosis
101152640 (MAPK14)
05415 Diabetic cardiomyopathy
101152640 (MAPK14)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
101152640 (MAPK14)
04932 Non-alcoholic fatty liver disease
101152640 (MAPK14)
04933 AGE-RAGE signaling pathway in diabetic complications
101152640 (MAPK14)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
101152640 (MAPK14)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:ggo01001]
101152640 (MAPK14)
Enzymes [BR:ggo01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
101152640 (MAPK14)
Protein kinases [BR:ggo01001]
Serine/threonine kinases: CMGC group
MAPK family [OT]
101152640 (MAPK14)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| Position |
5:join(53790755..53790870,53815231..53815360,53822124..53822182,53835712..53835823,53836534..53836563,53836892..53836939,53838693..53838807,53839382..53839453,53858258..53858337,53864859..53864937,53869782..53869955,53870708..53870775)
|
| AA seq |
360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| NT seq |
1083 nt +upstreamnt +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtatagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgaccggaaga
acattgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga |