KEGG   Gorilla gorilla gorilla (western lowland gorilla): 6742686
Entry
6742686           CDS       T02442                                 
Symbol
ND3, KEG83_p06
Name
(RefSeq) NADH dehydrogenase subunit 3
  KO
K03880  NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00190  Oxidative phosphorylation
ggo01100  Metabolic pathways
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05014  Amyotrophic lateral sclerosis
ggo05016  Huntington disease
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05208  Chemical carcinogenesis - reactive oxygen species
ggo05415  Diabetic cardiomyopathy
Module
ggo_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6742686 (ND3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    6742686 (ND3)
  09159 Environmental adaptation
   04714 Thermogenesis
    6742686 (ND3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    6742686 (ND3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6742686 (ND3)
   05012 Parkinson disease
    6742686 (ND3)
   05014 Amyotrophic lateral sclerosis
    6742686 (ND3)
   05016 Huntington disease
    6742686 (ND3)
   05020 Prion disease
    6742686 (ND3)
   05022 Pathways of neurodegeneration - multiple diseases
    6742686 (ND3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    6742686 (ND3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ggo03029]
    6742686 (ND3)
Enzymes [BR:ggo01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     6742686 (ND3)
Mitochondrial biogenesis [BR:ggo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    6742686 (ND3)
SSDB
Motif
Pfam: Oxidored_q4
Other DBs
NCBI-GeneID: 6742686
NCBI-ProteinID: YP_002120666
UniProt: G3RZR3
LinkDB
Position
MT:9483..9828
AA seq 115 aa
MNFALILMTNTLLALLLMIITFWLPQLNSYMEKTNPYECGFDPVSPARIPFSMKFFLVAI
TFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILTLSLAYEWLQKGLDWAE
NT seq 346 nt   +upstreamnt  +downstreamnt
ataaacttcgccctgatcttaataaccaacacccttctagccctactactaataattatt
acattttgactaccgcaacttaacagctacatagaaaaaactaacccctacgaatgtggt
ttcgaccccgtatcccccgcccgcattcctttctccataaaatttttcctagtagccatc
actttcttactatttgacctagaaattgccctcctattgcccctgccatgagccctacaa
acaaccaacttaccactaatagtcatgtcatccctcttattaatcattatcctaacccta
agtctagcctacgaatgactgcaaaaaggactagactgggccgaat

DBGET integrated database retrieval system