Gemmatimonas groenlandica: HKW67_02015 Help Entry HKW67_02015       CDS       T07783                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ggr  Gemmatimonas groenlandica Pathway ggr00190   Oxidative phosphorylation ggr01100   Metabolic pathways Module ggr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ggr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HKW67_02015 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ggr00194]     HKW67_02015 (atpE) Photosynthesis proteins [BR:ggr00194]  Photosystem and electron transport system   F-type ATPase [OT]    HKW67_02015 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QJR34382 UniProt:  A0A6M4IMZ0 LinkDB All DBs Position 494860..495138 Genome browser AA seq 92 aa AA seqDB search MEIMGLLQAAAPVVQDPKGMAMIGAGIAAGGAAIGAGMGIGRIGGSAVEGMARQPEAAGR IQTAALILAALIEGAALFGVVVGFLIQGKITF NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggaaatcatgggtctcctccaggccgctgcgccggttgttcaggatccgaagggcatg gccatgatcggcgccggcatcgctgccggtggtgccgcgatcggcgccggcatgggtatc ggccgcatcggtggttcggcggttgagggcatggcgcgtcagccggaagccgcgggtcgt attcagaccgccgcgctcatcctggccgcgctcatcgaaggcgccgcgctgttcggcgtc gtcgtcggcttcctgattcagggcaagatcacgttctaa

DBGET integrated database retrieval system