Geoalkalibacter halelectricus: L9S41_08155 Help Entry L9S41_08155       CDS       T09882                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ghc  Geoalkalibacter halelectricus Pathway ghc00020   Citrate cycle (TCA cycle) ghc00720   Other carbon fixation pathways ghc01100   Metabolic pathways ghc01110   Biosynthesis of secondary metabolites ghc01120   Microbial metabolism in diverse environments ghc01200   Carbon metabolism ghc01210   2-Oxocarboxylic acid metabolism Module ghc_M00009   Citrate cycle (TCA cycle, Krebs cycle) ghc_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ghc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L9S41_08155   09102 Energy metabolism    00720 Other carbon fixation pathways     L9S41_08155 Enzymes [BR:ghc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L9S41_08155 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_15 Fer4_17 Fer4_9 LdpA_Fe-S-bd Fer4_16 Fer4_4 Fer4_8 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  UWZ81352 UniProt:  A0ABY5ZTS7 LinkDB All DBs Position 1848208..1848432 Genome browser AA seq 74 aa AA seqDB search MAKLVIDESRCKGCALCTVACPHGLLQLRRTISRQGFFPVEIIPEKADRCTSCALCAQMC PDLAISVFREKKRG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccaaactcgttattgatgaatctcggtgcaagggttgcgcgctgtgtaccgtcgca tgcccccacgggttgctgcagttgcgccgcaccatcagtcggcagggattttttcccgtc gagatcattcccgaaaaggccgatcggtgcacctcctgcgccctctgcgcccagatgtgt cccgatctggccatcagcgtttttcgcgaaaagaaacgcggataa

DBGET integrated database retrieval system