Geoalkalibacter halelectricus: L9S41_15730 Help Entry L9S41_15730       CDS       T09882                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ghc  Geoalkalibacter halelectricus Pathway ghc00020   Citrate cycle (TCA cycle) ghc00720   Other carbon fixation pathways ghc01100   Metabolic pathways ghc01110   Biosynthesis of secondary metabolites ghc01120   Microbial metabolism in diverse environments ghc01200   Carbon metabolism ghc01210   2-Oxocarboxylic acid metabolism Module ghc_M00009   Citrate cycle (TCA cycle, Krebs cycle) ghc_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ghc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L9S41_15730   09102 Energy metabolism    00720 Other carbon fixation pathways     L9S41_15730 Enzymes [BR:ghc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L9S41_15730 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_21 Fer4_7 Fer4_6 Fer4_10 Fer4_2 Fer4_16 Fer4_4 Fer4_8 LdpA_Fe-S-bd Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  UWZ79114 UniProt:  A0ABY5ZN51 LinkDB All DBs Position 3430102..3430302 Genome browser AA seq 66 aa AA seqDB search MSSAKGTLEIIERYCKGCSICVEFCPTQVLEMDLFVVKAAKPEACIACMQCELRCPDFAI KVHKVA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcagcgcgaagggaacattggaaatcatcgaaagatactgtaaggggtgcagtatc tgtgtcgagttctgccccacccaggttctggagatggacctctttgtcgtcaaggccgcc aagccggaggcttgcatcgcctgtatgcagtgcgaactgcgctgtccggattttgccatc aaagttcataaagttgcctaa

DBGET integrated database retrieval system