Gossypium hirsutum (upland cotton): 107900802 Help Entry 107900802         CDS       T04793                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi04145   Phagosome ghi04148   Efferocytosis ghi04517   IgSF CAM signaling ghi04518   Integrin signaling ghi04620   Toll-like receptor signaling pathway ghi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ghi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107900802    04518 Integrin signaling     107900802  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107900802    04148 Efferocytosis     107900802  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107900802  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107900802  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107900802   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ghi04147]     107900802    04031 GTP-binding proteins [BR:ghi04031]     107900802 Membrane trafficking [BR:ghi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107900802  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107900802   Macropinocytosis    Ras GTPases     107900802  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107900802 Exosome [BR:ghi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107900802   Exosomal proteins of other body fluids (saliva and urine)    107900802   Exosomal proteins of colorectal cancer cells    107900802   Exosomal proteins of bladder cancer cells    107900802 GTP-binding proteins [BR:ghi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107900802 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C Motif Other DBs NCBI-GeneID:  107900802 NCBI-ProteinID:  XP_016682003 UniProt:  A0A1U8J089 A0A1U8LT99 LinkDB All DBs Position A08:complement(106802020..106807119) Genome browser AA seq 208 aa AA seqDB search MSTAAATAAATATTQTKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVM VDGQTVNLGIWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSYENVSKKWVPELRHYA PRAPIVLVGTKLDLRDDRRFHFDYPGACTISTEQGLELKKQIGALAYIECSSKTQQNVKA VFDAAIKVVLQPAKKKKQKKRTGICLVL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgagtacggcggcagcgacggcggcggcaacagctacaacacaaacgaaattcataaaa tgtgttacagttggggatggagctgttggaaagacttgtctccttatatcttatacaagc aacacttttccaactgattatgttcctactgtttttgacaacttcagcgccaatgtaatg gttgatgggcagactgtcaatttgggtatatgggatactgctggtcaggaagactacaac aggctaaggcctctaagttatagaggcgctgatgtgtttcttcttgctttctcccttatt agtaggcccagctatgagaacgtatcgaaaaaatgggttccagagctgagacattatgct ccgagagcgccgattgttcttgtggggaccaaactagatttaagagatgacagacggttc cacttcgattatcctggggcgtgtactatttctacagaacagggtcttgaactgaagaag caaataggagcactggcatacatagagtgcagctcaaagacacagcagaatgttaaagct gtatttgatgctgctatcaaggttgttcttcagcctgcaaagaaaaagaagcaaaagaag agaacaggtatatgccttgttctctaa

DBGET integrated database retrieval system