Gossypium hirsutum (upland cotton): 107921953 Help Entry 107921953         CDS       T04793                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03083   Polycomb repressive complex ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107921953    04120 Ubiquitin mediated proteolysis     107921953   09126 Chromosome    03083 Polycomb repressive complex     107921953  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107921953    04121 Ubiquitin system [BR:ghi04121]     107921953    03036 Chromosome and associated proteins [BR:ghi03036]     107921953 Membrane trafficking [BR:ghi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107921953 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107921953    Cul7 complex      107921953 Chromosome and associated proteins [BR:ghi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107921953   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107921953 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ HFX_2341_N Skp1 Motif Other DBs NCBI-GeneID:  107921953 NCBI-ProteinID:  XP_016707237 UniProt:  A0A1U8KXR9 LinkDB All DBs Position D01:complement(14640041..14640625) Genome browser AA seq 113 aa AA seqDB search MEFGTVKMYYEDNPDSCDEAIPLPNVTSKYLAKVIEYYKWHVEHRAKKAPKPVKIKFLQY EEEEDEEAKAFDKALFNTLDNEGMKQMIMAANYLDAKDLLEMLTQAVADRIKK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggagttcggcacggtgaagatgtactacgaagacaatccagactcgtgcgatgaagcc attccactccctaacgtgacatccaaatacctggcaaaagtgatcgaatactacaagtgg catgtagagcatcgagcgaagaaagcaccgaaacctgtaaaaatcaaattcttacagtac gaagaggaggaagacgaggaagctaaggcgtttgataaagcgctgttcaatacgctggac aacgagggaatgaaacagatgataatggcggctaactatctggatgcaaaagatctgctt gaaatgctgacgcaagcagtggcggataggataaaaaaataa

DBGET integrated database retrieval system