Gossypium hirsutum (upland cotton): 107923065 Help Entry 107923065         CDS       T04793                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03018   RNA degradation ghi03040   Spliceosome Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     107923065   09123 Folding, sorting and degradation    03018 RNA degradation     107923065  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ghi03019]     107923065    03041 Spliceosome [BR:ghi03041]     107923065 Messenger RNA biogenesis [BR:ghi03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      107923065   mRNA degradation factors    5'-3' decay     Lsm complex      107923065 Spliceosome [BR:ghi03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     107923065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  107923065 NCBI-ProteinID:  XP_016708763 UniProt:  A0A1U8L5V5 LinkDB All DBs Position A11:complement(16276834..16278591) Genome browser AA seq 87 aa AA seqDB search MANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITAEGR RITKLDQILLNGNNIAILVPGGSPDPE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcaaacaatccctcgcagcttcttccgtcagagttgatagataggtgcatagggtcc aaaatatgggtgataatgaaaggggacaaggagctcgtgggtactctaagaggcttcgat gtttacgtcaacatggtcctcgaagatgtcactgaatatgagatcaccgctgaaggaaga cgtatcacaaagcttgatcaaattttgcttaatggaaacaacatcgccattttggtccca ggaggctcacctgatcccgaatga

DBGET integrated database retrieval system