KEGG   Gossypium hirsutum (upland cotton): 107930152
Entry
107930152         CDS       T04793                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7 homolog B isoform X1
  KO
K03038  26S proteasome regulatory subunit N8
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03050  Proteasome
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    107930152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ghi03051]
    107930152
Proteasome [BR:ghi03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     107930152
SSDB
Motif
Pfam: JAB MitMem_reg
Other DBs
NCBI-GeneID: 107930152
NCBI-ProteinID: XP_016717215
UniProt: A0A1U8LRM1
LinkDB
Position
A04:complement(76388403..76390902)
AA seq 241 aa
MDVIKTQQISPRPIEKVIVHPLVLLSIVDNYNRVAKDTRKRVIGVLLGTSFKGTVDVTNS
YAVPFEEDEKDPSIWFLDHNYHESMFSMFKRINAKEHVVGWYSTGPKLRENDLDIHRLFH
NYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIAV
KHLLRDVKDTTISTLATEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQL
N
NT seq 726 nt   +upstreamnt  +downstreamnt
atggacgtgatcaaaacacagcaaatatcgcctcggccgattgagaaggtgatagtccac
cctttggttctcctcagtatcgtggacaactacaatcgcgtcgccaaagacacccgtaag
cgcgtcatcggagtccttcttggcacctccttcaaaggcaccgttgacgtcaccaacagc
tatgcagtgccttttgaggaagatgagaaggacccgagtatatggttccttgaccacaac
taccatgaatcaatgttttcaatgttcaaaaggattaatgccaaggagcatgttgttggt
tggtatagcactggcccaaaattacgggaaaatgatctagacattcacagattattccac
aactatgtcccaaatcctgtcttggtgattattgatgtccaacctaaggagttggggata
cccactaaggcctactatgatgttgaagaggtcaaggagaatgctactcaaaagagtcaa
aaggtttttgttcatgttccatctgaaattgctgctcacgaagttgaggagattgcagtg
aaacacttgcttagggatgtaaaggatacaacaattagtacacttgcaactgaggtcaca
gggaaactcacagctttgaagggtttggatgcgaggttacgggagatacgcggttacctt
gatcttgttattgatgagaagcttcctttgaatcatgaaatactttaccatttacagtta
aactaa

DBGET integrated database retrieval system