Gossypium hirsutum (upland cotton): 107932489 Help Entry 107932489         CDS       T04793                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi04145   Phagosome ghi04148   Efferocytosis ghi04620   Toll-like receptor signaling pathway ghi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ghi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107932489    04148 Efferocytosis     107932489  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107932489  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107932489  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107932489   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ghi04147]     107932489    04031 GTP-binding proteins [BR:ghi04031]     107932489 Membrane trafficking [BR:ghi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107932489  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107932489   Macropinocytosis    Ras GTPases     107932489  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107932489 Exosome [BR:ghi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107932489   Exosomal proteins of other body fluids (saliva and urine)    107932489   Exosomal proteins of colorectal cancer cells    107932489   Exosomal proteins of bladder cancer cells    107932489 GTP-binding proteins [BR:ghi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107932489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107932489 NCBI-ProteinID:  XP_040938516 UniProt:  Q9SWE8 LinkDB All DBs Position A12:complement(6583515..6587761) Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLREDKQFFIDHPGAVPITTAQGEELRKLIGAHFYIECSSKTQQNVKAVFDAAIKVVLQP PKKKKKKKRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttccaggttcataaaatgcgtcacggtcggtgacggtgccgtcggcaagact tgtctgctcatttcctacactagcaatactttccctaccgattatgtgccaactgtcttt gacaactttagtgctaatgtggttgtggatgggaacactgttaatctgggattgtgggat actgctggacaggaagattacaatagattaagaccattgagctatcgtggagcagatgtc ttcttgctggcattttctctcattagcaaagctagctatgaaaatgttgctaagaaatgg attccagaattgagacattatgcacccggtgttccaattattcttgttgggactaagctt gatcttcgagaagataagcagttcttcatagatcaccctggtgcggtgcccattaccaca gcacagggtgaggaattgagaaagctaattggagcgcatttttacattgagtgtagttca aaaacacaacagaatgtgaaagcggtctttgatgcggccatcaaagtagttctccagcct ccaaagaagaagaagaaaaagaagagaaaggcacaaaaagcttgctcaatattgtga

DBGET integrated database retrieval system