Gossypium hirsutum (upland cotton): 107932489 Help Entry 107932489         CDS       T04793                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi04145   Phagosome ghi04148   Efferocytosis ghi04517   IgSF CAM signaling ghi04518   Integrin signaling ghi04620   Toll-like receptor signaling pathway ghi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ghi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107932489    04518 Integrin signaling     107932489  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107932489    04148 Efferocytosis     107932489  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107932489  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107932489  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107932489   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ghi04147]     107932489    04031 GTP-binding proteins [BR:ghi04031]     107932489 Membrane trafficking [BR:ghi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107932489  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107932489   Macropinocytosis    Ras GTPases     107932489  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107932489 Exosome [BR:ghi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107932489   Exosomal proteins of other body fluids (saliva and urine)    107932489   Exosomal proteins of colorectal cancer cells    107932489   Exosomal proteins of bladder cancer cells    107932489 GTP-binding proteins [BR:ghi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107932489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107932489 NCBI-ProteinID:  XP_040938516 UniProt:  Q9SWE8 LinkDB All DBs Position A12:complement(6583515..6587761) Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLREDKQFFIDHPGAVPITTAQGEELRKLIGAHFYIECSSKTQQNVKAVFDAAIKVVLQP PKKKKKKKRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttccaggttcataaaatgcgtcacggtcggtgacggtgccgtcggcaagact tgtctgctcatttcctacactagcaatactttccctaccgattatgtgccaactgtcttt gacaactttagtgctaatgtggttgtggatgggaacactgttaatctgggattgtgggat actgctggacaggaagattacaatagattaagaccattgagctatcgtggagcagatgtc ttcttgctggcattttctctcattagcaaagctagctatgaaaatgttgctaagaaatgg attccagaattgagacattatgcacccggtgttccaattattcttgttgggactaagctt gatcttcgagaagataagcagttcttcatagatcaccctggtgcggtgcccattaccaca gcacagggtgaggaattgagaaagctaattggagcgcatttttacattgagtgtagttca aaaacacaacagaatgtgaaagcggtctttgatgcggccatcaaagtagttctccagcct ccaaagaagaagaagaaaaagaagagaaaggcacaaaaagcttgctcaatattgtga

DBGET integrated database retrieval system