Gossypium hirsutum (upland cotton): 107936972 Help Entry 107936972         CDS       T04793                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03083   Polycomb repressive complex ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107936972    04120 Ubiquitin mediated proteolysis     107936972   09126 Chromosome    03083 Polycomb repressive complex     107936972  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107936972    04121 Ubiquitin system [BR:ghi04121]     107936972    03036 Chromosome and associated proteins [BR:ghi03036]     107936972 Membrane trafficking [BR:ghi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107936972 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107936972    Cul7 complex      107936972 Chromosome and associated proteins [BR:ghi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107936972   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107936972 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  107936972 NCBI-ProteinID:  XP_016725260 UniProt:  A0A1U8MER4 LinkDB All DBs Position A01:complement(174058..174963) Genome browser AA seq 153 aa AA seqDB search MASTSKKIIVKSSDGETFEVVEAVALKLQPIKCMIEDDCADGEIPIPIVTGKILAKVLEY CNNHVDGKYGEPTTEFEEWEADFVKVDQTTLFDLISAANFLEIKSLLDLTCKTVANMMKG KSPVEIRKTFNIKNDFTPEEEEKIRRENAWAFD NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgacttccaagaagattatagtgaagagctccgacggagagactttcgaggtg gtcgaagcggtggcgcttaaattgcaacctatcaagtgcatgatcgaagatgactgcgcc gatggcgaaatccctatccccatcgtcaccggtaagatcttagccaaggtcctcgagtat tgcaacaaccatgtcgatggtaagtacggtgagccgactactgaatttgaagagtgggaa gctgatttcgtgaaagttgaccagaccaccctctttgatctcatctcggcggctaacttt ttggaaataaagagcttgctggatttgacgtgcaaaacggtggcgaacatgatgaaggga aagtcgccggtggagattcggaaaaccttcaacataaagaacgatttcacccctgaagaa gaagaaaagataaggagggagaacgcctgggctttcgattag

DBGET integrated database retrieval system