Gossypium hirsutum (upland cotton): 107940727 Help Entry 107940727         CDS       T04793                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi04145   Phagosome ghi04148   Efferocytosis ghi04517   IgSF CAM signaling ghi04518   Integrin signaling ghi04620   Toll-like receptor signaling pathway ghi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ghi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107940727    04518 Integrin signaling     107940727  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107940727    04148 Efferocytosis     107940727  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107940727  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107940727  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107940727   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ghi04147]     107940727    04031 GTP-binding proteins [BR:ghi04031]     107940727 Membrane trafficking [BR:ghi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107940727  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107940727   Macropinocytosis    Ras GTPases     107940727  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107940727 Exosome [BR:ghi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107940727   Exosomal proteins of other body fluids (saliva and urine)    107940727   Exosomal proteins of colorectal cancer cells    107940727   Exosomal proteins of bladder cancer cells    107940727 GTP-binding proteins [BR:ghi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107940727 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf B12-binding Motif Other DBs NCBI-GeneID:  107940727 NCBI-ProteinID:  XP_016729662 UniProt:  A0A1U8MS37 LinkDB All DBs Position D06:complement(11211..13178) Genome browser AA seq 196 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVTKKWIPELKHYAPGVPIVLVGTKL DLRDDQQFFVDHPGAVPISTAQGEELRKQVGSSAYIECSSKTQQNVKAVFDSAIKVVLQP PKKSKKKKAHGGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctccagattcataaagtgtgttactgtcggcgatggtgctgtcggcaaaact tgcttgcttatttcctacaccagcaacactttccctacggattatgtccctactgttttc gacaatttcagtgcaaatgttgttgtggatggcagcactgtcaacttgggtttatgggat actgctggtcaagaggattacaatagattgagaccattaagctatcgtggggccgatgtc tttattcttgcattttccctcatcagcaaggctagttacgaaaatgttacaaagaagtgg attcctgaattaaagcattatgcacctggtgttccgatagttcttgttggaactaagctt gatctccgggatgatcagcaattctttgtagaccatcctggtgcagtgcccatttctaca gctcagggtgaagaattaaggaaacaggtagggtcttctgcctacatcgagtgtagttca aaaacacagcagaatgtgaaggcagtttttgattcagctattaaggtagtgcttcagcct ccgaagaaaagcaagaagaaaaaggcacatggtggttgctcaatattgtga

DBGET integrated database retrieval system