Gossypium hirsutum (upland cotton): 107941434 Help Entry 107941434         CDS       T04793                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ghi  Gossypium hirsutum (upland cotton) Brite KEGG Orthology (KO) [BR:ghi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ghi03041]     107941434   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ghi04052]     107941434 Spliceosome [BR:ghi03041]  Complex B   Other components    Complex B specific factors     107941434 Cytokines and neuropeptides [BR:ghi04052]  Neuropeptides   Unclassified    107941434 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  107941434 NCBI-ProteinID:  XP_016730486 UniProt:  A0A1U8N1J4 LinkDB All DBs Position A06:122485723..122486161 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgttgaacgatcggctagggaagaaagtgcgcgtgaagtgcaacgac gacgacacgatcggagaccttaagaagctggtcgcggcccaaactggaactcgagcagac aagatccgtatccagaagtggtacacggtttacaaggatcatattaccctcaaagattac gaaatccacgacggtatgggtctcgaactttactacaattaa

DBGET integrated database retrieval system