Gossypium hirsutum (upland cotton): 107943505 Help Entry 107943505         CDS       T04793                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03083   Polycomb repressive complex ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107943505    04120 Ubiquitin mediated proteolysis     107943505   09126 Chromosome    03083 Polycomb repressive complex     107943505  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107943505    04121 Ubiquitin system [BR:ghi04121]     107943505    03036 Chromosome and associated proteins [BR:ghi03036]     107943505 Membrane trafficking [BR:ghi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107943505 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107943505    Cul7 complex      107943505 Chromosome and associated proteins [BR:ghi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107943505   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107943505 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  107943505 NCBI-ProteinID:  XP_016732742 UniProt:  J7FXM2 J7FEN2 LinkDB All DBs Position A02:107731742..107734065 Genome browser AA seq 156 aa AA seqDB search MSSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEY CKKHVEAPKTDDRSADDELKSWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcggggaggaagatcacccttaagagctcagacggcgaatcattcgaggtt gatgaagcggtggcgttggagtcgcagacgattaagcatatgatcgaggacgattgcgct gataacgggataccgttgcctaatgttacgagcaagatcttagcgaaggtgatcgagtac tgcaagaaacacgtcgaggctcctaagacagacgatcgatccgccgatgacgagctcaag agttgggacgctgactttgtcaaggtcgatcaagctactctctttgatctcattctggca gcgaactatttgaacatcaagggcttgctggatctcacttgccaaactgttgctgacatg atcaagggaaagaccccagaagagatcaggaagactttcaatatcaagaatgacttcacc ccggaagaggaagaagaggttcgtcgggagaaccagtgggcattcgaatga

DBGET integrated database retrieval system