Gossypium hirsutum (upland cotton): 107946589 Help Entry 107946589         CDS       T04793                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     107946589  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ghi03400]     107946589 DNA repair and recombination proteins [BR:ghi03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      107946589 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  107946589 NCBI-ProteinID:  XP_016736478 UniProt:  A0ABM3B7V3 A0A1U8NET5 LinkDB All DBs Position A12:complement(99494684..99496690) Genome browser AA seq 108 aa AA seqDB search MDDNEAPIFEPDLIRAIFKHIWIKRAQERERNGFPNTEAGDSEVGAGTSKKNRPTSANTN ALKLSCELLRIFITEAIQRAGTIAEAEGSTMIEPTHLERILPQLLLDF NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggatgacaatgaagctcccattttcgaaccagatttaattagagccattttcaagcac atttggataaaaagagctcaagagcgtgaaaggaacggattcccaaacactgaggccgga gattccgaggttggagctggaacatcaaagaagaatcgacccacttccgctaatacaaat gccttgaagctgagttgtgaacttcttcggatttttatcacagaggctattcagcgagct ggtacaattgctgaagctgagggtagtaccatgattgaaccaactcatttagaaaggatt cttcctcaattacttctggatttttaa

DBGET integrated database retrieval system