Gossypium hirsutum (upland cotton): 107946749
Help
Entry
107946749 CDS
T04793
Name
(RefSeq) abscisic acid receptor PYR1-like
KO
K14496
abscisic acid receptor PYR/PYL family
Organism
ghi
Gossypium hirsutum (upland cotton)
Pathway
ghi04016
MAPK signaling pathway - plant
ghi04075
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:
ghi00001
]
09130 Environmental Information Processing
09132 Signal transduction
04016 MAPK signaling pathway - plant
107946749
04075 Plant hormone signal transduction
107946749
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Polyketide_cyc2
Polyketide_cyc
FTHFS
Bet_v_1
Motif
Other DBs
NCBI-GeneID:
107946749
NCBI-ProteinID:
XP_016736689
UniProt:
A0A1U8NFT6
LinkDB
All DBs
Position
A12:complement(102518504..102519486)
Genome browser
AA seq
210 aa
AA seq
DB search
MAVSKPAPFSSFSQTTTHHLTLPPGISHDEFHDLIPSITQLHNYSVGPGKCSSLLAKRIS
APHDLVWSIVRRFDKPQAYKHFIRSCAVEQGSQMVVGCTRKVNVISGLPADTSTERLDIL
DDERRVTGFSIIGGEHRLRNYRSVTTVHGFNRNGRIWTVVLESYVVDVPEGNTEEDTRLF
ANTVVKLNLQKLASVTEGLARDDDNDGNNS
NT seq
633 nt
NT seq
+upstream
nt +downstream
nt
atggcagtctcaaaacccgctcctttctcttccttctcccaaaccaccactcaccacctc
acccttccccccggcatatcccacgacgagttccacgacttaatcccttccataacccag
ttgcacaactactcagttggtcccggaaaatgctcttccttactagccaaacgtatcagc
gccccacacgaccttgtctggtccatcgtccgccgttttgacaaaccccaagcttacaaa
catttcatccgaagctgtgccgttgaacaaggttcgcaaatggtggtggggtgcacgcgt
aaggtcaacgtgatctccggcttacctgctgataccagcaccgagagactggatatttta
gacgacgaacgacgggtcaccgggtttagtatcattggaggggagcaccgattgaggaat
taccggtctgtgacgactgtacacggtttcaatcgtaacgggaggatctggaccgtcgtt
ttggaatcttacgttgtcgatgttccggaaggtaatacggaggaagacacgcggctgttc
gccaacaccgttgtgaagttgaacttgcaaaagctagcgtctgttaccgaagggttagcg
cgtgatgatgataatgacggtaataattcatag
DBGET
integrated database retrieval system