Gossypium hirsutum (upland cotton): 107947149 Help Entry 107947149         CDS       T04793                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03083   Polycomb repressive complex ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107947149    04120 Ubiquitin mediated proteolysis     107947149   09126 Chromosome    03083 Polycomb repressive complex     107947149  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107947149    04121 Ubiquitin system [BR:ghi04121]     107947149    03036 Chromosome and associated proteins [BR:ghi03036]     107947149 Membrane trafficking [BR:ghi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107947149 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107947149    Cul7 complex      107947149 Chromosome and associated proteins [BR:ghi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107947149   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107947149 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  107947149 NCBI-ProteinID:  XP_016737210 UniProt:  A0A1U8NDW1 LinkDB All DBs Position A01:107329936..107331207 Genome browser AA seq 156 aa AA seqDB search MASTSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILSKVLEY CKKHVDAAADKEKTPDDELKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgacttcgaggaagataatgttgaggagctccgacggagagacttttgaggtg gaggaagcggtggcggttgagtcgcagacgatcaagcacatgatcgaggacgattgcgcc gacaacgagatccctctcccaaacgtcaccagcaagatcttgtccaaggtccttgagtac tgcaagaagcatgtcgatgctgctgccgacaaggaaaagactcctgatgacgaactcaag gtttgggatgctgattttgtcaaggttgaccaaaataccctctttgatctcatcctggca gcgaactatctgaatatcaagagcttgctggacttgacctgccaaactgtggctgatatg ataaagggaaagacacccgaggagattcgcaagaccttcaacatcaagaacgatttcacc cccgaggaagaagaggaggttaggagggagaatcaatgggcattcgagtga

DBGET integrated database retrieval system