Gossypium hirsutum (upland cotton): 107951714 Help Entry 107951714         CDS       T04793                                  Name (RefSeq) ubiquitin isoform X2   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03010   Ribosome ghi04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     107951714   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107951714  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ghi03011]     107951714    04121 Ubiquitin system [BR:ghi04121]     107951714 Ribosome [BR:ghi03011]  Ribosomal proteins   Eukaryotes    Large subunit     107951714   Archaea     107951714 Ubiquitin system [BR:ghi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    107951714 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_L40e Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Dsc3_N DUF2604 UBL_UBAC1 Ubiquitin_5 OTU1_UBXL Motif Other DBs NCBI-GeneID:  107951714 NCBI-ProteinID:  XP_016742333 UniProt:  A0A1U8NWI5 LinkDB All DBs Position D11:71898411..71905608 Genome browser AA seq 104 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIDNVKANIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLRGGIIEPSLMALARKYNQDKMICRKWNEGES NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagatattcgtgaaaaccctaaccggcaagaccataactctcgaggtcgagagcagc gacaccatcgataatgtcaaagccaatatccaagacaaagaaggaattcccccggaccaa caacgtttaatttttgctggtaaacaacttgaagatggccgtacattggctgattacaac attcaaaaagaatcaacgcttcatcttgttttaaggttgagaggtggaattattgagcct tctttaatggctttggctcgtaaatacaaccaagacaaaatgatttgccgcaagtggaat gaaggtgaaagctga

DBGET integrated database retrieval system