Gossypium hirsutum (upland cotton): 107953131 Help Entry 107953131         CDS       T04793                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi04016   MAPK signaling pathway - plant ghi04070   Phosphatidylinositol signaling system ghi04075   Plant hormone signal transduction ghi04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ghi00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     107953131    04070 Phosphatidylinositol signaling system     107953131    04075 Plant hormone signal transduction     107953131  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     107953131  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ghi01009]     107953131   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     107953131    03036 Chromosome and associated proteins [BR:ghi03036]     107953131   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ghi04147]     107953131 Protein phosphatases and associated proteins [BR:ghi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107953131 Membrane trafficking [BR:ghi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107953131 Chromosome and associated proteins [BR:ghi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107953131 Exosome [BR:ghi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107953131 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen EF-hand_EFHB_C Caleosin MotA_activ FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  107953131 NCBI-ProteinID:  XP_016743848 UniProt:  A0A1U8J5B7 LinkDB All DBs Position A07:22271502..22273611 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctcaccgatgatcagatctctgagttcaaggaggcctttagcctattc gacaaggacggcgatggctgcattactaccaaggagctcgggactgtgatgcgatcactt gggcagaaccctactgaggcagaacttcaagatatgattaatgaagttgatgctgatgga aatgggaccatcgattttcctgaattccttaacctgatggcgaggaagatgaaggatact gattctgaggaggaacttaaagaggctttcagggtttttgacaaggatcagaatggtttc atatcagctgctgagctgcgccatgtcatgacaaatctcggtgagaagcttacagatgag gaggttgatgaaatgatccgtgaagccgatgttgatggtgacgggcagatcaactatgag gagtttgttaaagtcatgatggccaagtaa

DBGET integrated database retrieval system