KEGG   Gossypium hirsutum (upland cotton): 107963871
Entry
107963871         CDS       T04793                                 
Name
(RefSeq) signal peptidase complex subunit 3B isoform X1
  KO
K12948  signal peptidase complex subunit 3 [EC:3.4.-.-]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03060  Protein export
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107963871
SSDB
Motif
Pfam: SPC22
Other DBs
NCBI-GeneID: 107963871
NCBI-ProteinID: XP_016755866
UniProt: A0A1U8PXK0
LinkDB
Position
A03:complement(6558192..6560810)
AA seq 167 aa
MHSFGYRLNGLLTFAVTILALMCAITSLSDNFNTPSPSAEIKIMNINWFQKQPQGHDEVS
LTMNVSADLQSLFTWNTKQVFIFVAAEYETRKNSLNQVSLWDAIIPAKEHAKFWIHTSNK
YRFVDQGNNLRGKKFNLTLHWHVMPKTGKMFADKIVLTGYSLPEEYR
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcattcttttgggtacagattaaatggtttgctaacgtttgccgtgactattctagcg
ctaatgtgcgccatcacatctctctcggacaacttcaacactccctctccctctgcagag
atcaagattatgaacattaattggttccagaagcagccacaggggcatgatgaggtcagc
ctaacgatgaatgtatcagctgatttgcagtcattgtttacttggaacacaaaacaggta
ttcatttttgtagcagctgagtacgaaacccgaaagaattccttgaatcaggtctcactt
tgggatgccattatacctgccaaagaacatgctaagttttggatccacacctcaaacaag
tatcgctttgttgatcagggaaacaatctccgtggcaaaaaattcaacttaacattgcac
tggcatgtcatgcctaagaccggaaagatgtttgctgacaaaatagtcctgaccggttat
agcttgccagaggaatatagataa

DBGET integrated database retrieval system