Gossypium hirsutum (upland cotton): 121222104 Help Entry 121222104         CDS       T04793                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03083   Polycomb repressive complex ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121222104    04120 Ubiquitin mediated proteolysis     121222104   09126 Chromosome    03083 Polycomb repressive complex     121222104  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ghi04131]     121222104    04121 Ubiquitin system [BR:ghi04121]     121222104    03036 Chromosome and associated proteins [BR:ghi03036]     121222104 Membrane trafficking [BR:ghi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     121222104 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      121222104    Cul7 complex      121222104 Chromosome and associated proteins [BR:ghi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      121222104   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      121222104 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DUF6650 Motif Other DBs NCBI-GeneID:  121222104 NCBI-ProteinID:  XP_040957946 LinkDB All DBs Position D10:complement(60600410..60600978) Genome browser AA seq 139 aa AA seqDB search MLSSKNSALESKDNEIFEVEESIAIQSELIKTMATMVNSKAYVNEPNYHVEQNNKIVDEE LSDWESKFFEVDMDDLHELFMAANYLEIESLLNGVAKRVADIIKACMNVEVIRQTFGINN DFAAQQEEEIRKLNSWNHI NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgttgtcgtccaagaattctgcattggagagcaaagacaatgaaatctttgaggtcgaa gaatccattgccattcaatctgagctcatcaaaaccatggcgaccatggtgaacagcaag gcctacgttaacgaacccaattatcacgtcgagcaaaacaacaaaattgttgatgaagaa ctaagcgattgggaatcaaaattctttgaggttgatatggatgatcttcacgagcttttc atggcagccaattacctggaaattgaaagcttgttgaatggagtggcgaaacgagttgcg gacattatcaaagcttgcatgaatgttgaggtaattcgtcaaacttttggaattaacaac gattttgctgctcaacaagaagaggaaattcgtaagcttaattcttggaaccatatttga

DBGET integrated database retrieval system