Guyparkeria halophila: GM160_01590
Help
Entry
GM160_01590 CDS
T06369
Name
(GenBank) adenylate kinase
KO
K00939
adenylate kinase [EC:
2.7.4.3
]
Organism
ghl
Guyparkeria halophila
Pathway
ghl00230
Purine metabolism
ghl00730
Thiamine metabolism
ghl01100
Metabolic pathways
ghl01110
Biosynthesis of secondary metabolites
ghl01232
Nucleotide metabolism
ghl01240
Biosynthesis of cofactors
Module
ghl_M00049
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:
ghl00001
]
09100 Metabolism
09104 Nucleotide metabolism
00230 Purine metabolism
GM160_01590
09108 Metabolism of cofactors and vitamins
00730 Thiamine metabolism
GM160_01590
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
ghl04147
]
GM160_01590
Enzymes [BR:
ghl01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.4 Phosphotransferases with a phosphate group as acceptor
2.7.4.3 adenylate kinase
GM160_01590
Exosome [BR:
ghl04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
GM160_01590
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ADK
AAA_17
ADK_lid
AAA_33
AAA_18
Hydin_ADK
AAA_28
Zn_ribbon_8
HypA
zf-C2HC5
DUF7340
Zn_ribbon_4
Ploopntkinase3
nSTAND3
zf-C2H2_6
Motif
Other DBs
NCBI-ProteinID:
QGT77686
UniProt:
A0A6I6CTA5
LinkDB
All DBs
Position
complement(341199..341864)
Genome browser
AA seq
221 aa
AA seq
DB search
MRIVLLGAPGSGKGTQAARLVEHYKVPQISTGDLLRAAVAAGTELGLKAKAAMDEGQLVS
DDIVLGMIRERLAQPDTQRGFILDGFPRNIAQAEALDEMLEGLERPLELGILLDVPLDKL
MKRLTGRMTCKECGAVFNRFTNPPDSDHQCDHCEHELVQRNDDNEDTVRRRLEVFQEQTA
PLVEYYERDGRLARIDGEREIDQIAADFREILDPIAPSSES
NT seq
666 nt
NT seq
+upstream
nt +downstream
nt
atgcgaatcgtacttttgggcgccccgggttcgggcaagggcacgcaggcggcacgcctg
gtggaacactacaaggtcccgcagatctccaccggcgacctgctgcgcgccgccgtggcc
gcgggcaccgagctcggcctcaaggccaaggccgcgatggacgaaggccagctggtcagt
gacgacatcgtactgggcatgatccgcgagcgcctggcccaaccggacacccagcgcggt
ttcatcctcgacggcttcccgcgcaacatcgcccaggccgaggcgctcgacgagatgctc
gaaggcctcgagcgcccgctggagctcggcatcctcctggacgtgccgctcgacaagctg
atgaagcgcctgaccggccgcatgacctgcaaggaatgcggcgcggtgttcaatcgcttc
accaatccgccggattccgaccaccagtgcgaccactgcgagcacgaactggttcagcgc
aacgacgacaacgaggacaccgtgcgtcgccgcctggaggtattccaggagcagacggcg
ccgttggtcgagtactacgagcgcgacgggcgactggcccgcatcgacggcgaacgggaa
atcgaccagatcgcggcggacttccgcgagatcctcgacccgatcgccccgtcatccgag
agctga
DBGET
integrated database retrieval system