Guyparkeria halophila: GM160_03430 Help Entry GM160_03430       CDS       T06369                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ghl  Guyparkeria halophila Pathway ghl01100   Metabolic pathways ghl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ghl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GM160_03430 (acpP)    00074 Mycolic acid biosynthesis     GM160_03430 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GM160_03430 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QGT78021 UniProt:  A0A6I6D3U0 LinkDB All DBs Position 736480..736719 Genome browser AA seq 79 aa AA seqDB search MSTVEERVKKIVVEQLGVKEEEVTNEASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNNHKDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgttgaagaacgcgtcaagaagattgttgtagagcagttgggcgtcaaggaa gaagaagtcaccaatgaagcttcattcgttgacgacctcggcgcggattccctggatacc gtcgagctggtcatggcgctggaagaagagttcgagtgcgagattccggacgaagaggcc gagaagatcaccaccgttcagcaggccatcgactacgtcaacaaccacaaggacgcctga

DBGET integrated database retrieval system