KEGG   Gleimia hominis: CJ187_007735
Entry
CJ187_007735      CDS       T09100                                 
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
ghm  Gleimia hominis
Pathway
ghm02024  Quorum sensing
ghm03060  Protein export
ghm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ghm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CJ187_007735 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CJ187_007735 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CJ187_007735 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ghm03029]
    CJ187_007735 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ghm02044]
    CJ187_007735 (yidC)
Mitochondrial biogenesis [BR:ghm03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    CJ187_007735 (yidC)
Secretion system [BR:ghm02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   CJ187_007735 (yidC)
SSDB
Motif
Pfam: 60KD_IMP OSTbeta
Other DBs
NCBI-ProteinID: WIK64186
LinkDB
Position
complement(1764470..1765801)
AA seq 443 aa
MWFDKLLYPFKVVVAWIMVRLHDLLVFLGMDDGPGIAWILSIVGLTVLVRIILIPLFFRQ
IRASRNMQLVQPELKKLQEKYKGKTDQASRQRQSEEMMALYRENGTSPFSSCLPILAQMP
IFFALFRVLASTSQIAAGTYAGGANIGPLNSRLASDIENSTLFGAPLSASFTTTNLFSSK
VVIVVMILLMVFTQFITMRQLTMKNMPASATSSDNPMMRSQRMMMYMMPAVIGVSGFFFQ
VGVLIYWFTTNLWTMGQQFWTIARMPTPGSDAYNKLTVRRRKEYVEWARPEFEKYDEQYR
SLSDDDSQEREQLLARTLKSIKSQARKQKVPTKFPDDVTPEVQLSAYRELAFNEWDGLPD
ERWAKRFKPRAATKQRRGEQPKRLTKRERDQKAAAARRRAEREAQMKKRKKAKTKLSAQE
LEQRRQERRKQRREAGKKKKKDK
NT seq 1332 nt   +upstreamnt  +downstreamnt
gtgtggtttgacaaacttctctacccgttcaaggtagtggtggcttggattatggtgcgc
ctgcacgacctgttggtgttcctcgggatggatgacgggccgggtatcgcatggattttg
tccatcgtgggcctgactgtgctggtgcgcattattttgattcctctgttctttaggcag
attcgtgcctcacgcaatatgcagctggtgcagccggagctgaagaagctgcaggagaag
tacaagggaaaaacggaccaggcgagtaggcagcgtcagagtgaggaaatgatggcgctc
taccgggagaatgggacgagcccgttctcttcgtgcctgccgattttggcgcagatgccg
attttctttgctctgttccgcgtgttggcatccacttcccagattgcggccggtacgtac
gcggggggtgcgaatattgggccgttgaactcgcggttggcatccgatattgaaaactcc
acgctgtttggggctccgctttcagcgagctttacgacgactaacctgttctcgtcgaaa
gtcgtgattgtggtgatgattcttctgatggtgttcacgcagttcatcactatgcggcag
ttgacgatgaagaacatgccggcgtcggcaaccagttcggataacccgatgatgcgtagc
caacgcatgatgatgtacatgatgccggcagttatcggtgtttctgggttcttcttccag
gtgggtgtgctgatttactggttcaccacgaacttgtggacgatgggccagcagttctgg
actatcgcgcggatgcccacgccgggttcggatgcatacaataagctgacggtgcggcgt
cggaaagagtatgtggagtgggcgcgcccggagtttgagaaatatgatgagcagtaccgt
tcactttcggatgatgattcacaggagcgggagcagcttttagcgcgcaccctcaagagc
attaaatcgcaggcacgtaagcagaaggtgccaacgaaatttcctgatgatgtgacgcct
gaggtacagttgtcggcctatcgggaattggcgtttaacgagtgggatggtttgcccgat
gagcggtgggcgaaacggtttaaaccccgcgctgcgacgaagcaaaggcgtggtgaacag
ccgaaacgtttaacgaagcgggagcgtgatcagaaggcagctgcggctaggcggcgtgct
gaacgtgaagcgcagatgaagaagcggaagaaagcgaaaactaagttgtctgcgcaggag
ttggagcagcgtaggcaggaacgtcggaagcaacgccgggaagccggtaagaaaaagaag
aaggataagtaa

DBGET integrated database retrieval system