Grimontia hollisae: AL542_11030 Help Entry AL542_11030       CDS       T04260                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism gho  Grimontia hollisae Brite KEGG Orthology (KO) [BR:gho00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gho03110]     AL542_11030 (groES)    03029 Mitochondrial biogenesis [BR:gho03029]     AL542_11030 (groES) Chaperones and folding catalysts [BR:gho03110]  Heat shock proteins   HSP10    AL542_11030 (groES) Mitochondrial biogenesis [BR:gho03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AL542_11030 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AMG30843 UniProt:  A0A377HJI0 LinkDB All DBs Position 1:1545655..1545945 Genome browser AA seq 96 aa AA seqDB search MNIRPLHDRVIVERQEVESKSAGGIVLTGSAAEKSTRGVVLAVGKGRILENGNVQPLDVK VGDTVIFSEGYGTKTEKIDGKEVLILSENDIMAIVE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacattcgtccactacatgatcgagtaatcgttgaacgccaggaagttgaatcaaaa tctgctggtggcatcgttttgacgggttcagctgcagaaaaatctacccgtggtgttgtg ctggcggtaggcaaaggccgtattcttgaaaacggcaacgtgcagccactggacgttaaa gttggcgacacggttattttctcagaaggttatggcacaaaaaccgaaaaaattgacggt aaagaagtcctgatcctgtctgaaaacgacatcatggctatcgttgagtaa

DBGET integrated database retrieval system