Gaoshiqia hydrogeniformans: ACOIT5_02140 Help Entry ACOIT5_02140      CDS       T11085                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ghy  Gaoshiqia hydrogeniformans Pathway ghy00020   Citrate cycle (TCA cycle) ghy00720   Other carbon fixation pathways ghy01100   Metabolic pathways ghy01110   Biosynthesis of secondary metabolites ghy01120   Microbial metabolism in diverse environments ghy01200   Carbon metabolism ghy01210   2-Oxocarboxylic acid metabolism Module ghy_M00009   Citrate cycle (TCA cycle, Krebs cycle) ghy_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ghy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ACOIT5_02140   09102 Energy metabolism    00720 Other carbon fixation pathways     ACOIT5_02140 Enzymes [BR:ghy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ACOIT5_02140 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_2 Fer4_7 Fer4_6 Fer4_21 Fer4_9 Fer4_16 Fer4_4 LdpA_Fe-S-bd Fer4_15 Fer4_3 Fer4_22 Fer4_8 Fer4_17 Fer4_13 Motif Other DBs NCBI-ProteinID:  XQW73605 LinkDB All DBs Position complement(518254..518478) Genome browser AA seq 74 aa AA seqDB search MAKVIGAVVVDTEECKGCALCVVACPQQVLGQNKQVNSRGYHYSFMENPEACIGCSNCAV VCPDSCITVYRVKL NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagttattggagcagtggtggttgacactgaagaatgtaaaggctgcgccctg tgtgtggtagcttgcccgcaacaggtacttggacaaaacaagcaagtgaacagccgcgga tatcattattcgtttatggaaaatccggaggcctgtatcggttgttcaaactgcgcggtg gtttgccccgacagctgtattacggtttatcgggttaaattgtag

DBGET integrated database retrieval system