Gilvimarinus sp. DA14: NHM04_01790 Help Entry NHM04_01790       CDS       T08272                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gil  Gilvimarinus sp. DA14 Pathway gil01100   Metabolic pathways gil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NHM04_01790 (acpP)    00074 Mycolic acid biosynthesis     NHM04_01790 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NHM04_01790 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Gag_p24_C Motif Other DBs NCBI-ProteinID:  UTF60552 UniProt:  A0A9J7A888 LinkDB All DBs Position 432252..432488 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEDEVKAEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINANLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgcgtaaaaaaaatcgttgctgagcaactgggcgttaaagaa gatgaagtgaaagccgaggcttctttcgttgaagatttgggcgcggactctctggatact gtagagctggtgatggctctggaagaagagtttgaaaccgagattccggatgaagaagcc gagaaaatcaccactgttcagttggctatcgattacatcaatgccaatctggcctaa

DBGET integrated database retrieval system