Gilvimarinus sp. DA14: NHM04_14810 Help Entry NHM04_14810       CDS       T08272                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gil  Gilvimarinus sp. DA14 Pathway gil01100   Metabolic pathways gil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NHM04_14810    00074 Mycolic acid biosynthesis     NHM04_14810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NHM04_14810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  UTF59723 UniProt:  A0A9J7A6P5 LinkDB All DBs Position 3376983..3377231 Genome browser AA seq 82 aa AA seqDB search MNKDEIYSELKTVLINSFMIEEEDISPEADLYADLDFDSIDAIDLAAKIHSVTGKQLKPE QFKGVRTIGDAVNVIDELLRAG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaataaagacgaaatttacagtgaactgaaaaccgtcctcatcaattcatttatgatc gaggaagaggacatttctcccgaggcagatctttacgccgatctggatttcgatagcatt gatgctattgatctggccgccaaaattcacagcgtgaccggcaagcagcttaagcccgag cagtttaaaggcgtacgcaccattggtgatgcggttaacgtcatcgacgagcttttgagg gcggggtga

DBGET integrated database retrieval system