Gordonia iterans: C6V83_12425 Help Entry C6V83_12425       CDS       T05370                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism git  Gordonia iterans Pathway git00362   Benzoate degradation git00621   Dioxin degradation git00622   Xylene degradation git01100   Metabolic pathways git01120   Microbial metabolism in diverse environments git01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:git00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     C6V83_12425    00622 Xylene degradation     C6V83_12425    00621 Dioxin degradation     C6V83_12425 Enzymes [BR:git01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      C6V83_12425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  AVM00942 UniProt:  A0A2S0KGY2 LinkDB All DBs Position complement(2711185..2711364) Genome browser AA seq 59 aa AA seqDB search MPLIQISQTPGLSDRVKNETIAAVTEAYARATGKDPDSVWVTINEIPRTQWGVGGVPLG NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgccgctcatccagatctcccagacacccggcctgagtgaccgggtgaagaacgagacc atcgccgcggtcaccgaggcgtacgcgcgcgcgaccgggaaggacccggattcggtgtgg gtgacgatcaacgagatcccgcgcacccagtggggcgtcggcggggtgcccctcggatga

DBGET integrated database retrieval system