Gordonia iterans: C6V83_13395 Help Entry C6V83_13395       CDS       T05370                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism git  Gordonia iterans Pathway git01100   Metabolic pathways git01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:git00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C6V83_13395    00074 Mycolic acid biosynthesis     C6V83_13395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C6V83_13395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AVM01099 UniProt:  A0A2S0KHE1 LinkDB All DBs Position 2920717..2921019 Genome browser AA seq 100 aa AA seqDB search MAATQEQLIAGIAEIIEEVTGIEPSEVTLEKSFVDDLDIDSLSMVEIAVQVEDKYGVKVP DEDLAGLRTVGDTVAYIQKLEAENPEAAAAIAAQIEADQN NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctgctactcaggaacaactcatcgccggtatcgccgagatcatcgaagaggtcacc ggcatcgagccgtccgaggtcaccttggagaagtctttcgtcgacgacctggacatcgat tcgctgtcgatggtcgagatcgccgtccaggtggaggacaagtacggcgtcaaggtcccg gacgaggacctcgccggcctgcgcaccgtcggcgacaccgtcgcctacatccagaagctg gaggccgagaaccccgaggccgctgccgccatcgcggcccagatcgaggctgaccagaac tga

DBGET integrated database retrieval system