Gordonia iterans: C6V83_15410 Help Entry C6V83_15410       CDS       T05370                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism git  Gordonia iterans Brite KEGG Orthology (KO) [BR:git00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     C6V83_15410 Enzymes [BR:git01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      C6V83_15410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_3 GST_N_2 Glrx-like CLIC-like_N DUF5896 Motif Other DBs NCBI-ProteinID:  AVM01422 UniProt:  A0A2S0KIA7 LinkDB All DBs Position complement(3340680..3340928) Genome browser AA seq 82 aa AA seqDB search MAGMASLTVYTTSWCPFCVRLKRSLTLQNVDFTEIDVEADADAAAFVESVNGGDRVVPTV KYDDGSTQTNPGIGEVLAKLGR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccggtatggcctctctgaccgtgtacaccacctcctggtgcccgttctgcgtccgt ctcaagcggagtctgacgctgcagaacgtcgacttcacggagatcgacgtcgaagccgat gcggacgccgccgcgttcgtcgagagcgtgaacggcggtgaccgcgtggtgccgacggtg aagtacgacgacgggtccacccagaccaatccgggcatcggcgaggtgctcgcgaagctc ggccgctga

DBGET integrated database retrieval system