Gekko japonicus (Schlegel's Japanese gecko): 107125984
Help
Entry
107125984 CDS
T04299
Symbol
SKP1
Name
(RefSeq) S-phase kinase associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
gja
Gekko japonicus (Schlegel's Japanese gecko)
Pathway
gja03083
Polycomb repressive complex
gja04110
Cell cycle
gja04114
Oocyte meiosis
gja04120
Ubiquitin mediated proteolysis
gja04141
Protein processing in endoplasmic reticulum
gja04310
Wnt signaling pathway
gja04350
TGF-beta signaling pathway
gja05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
gja00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
107125984 (SKP1)
04120 Ubiquitin mediated proteolysis
107125984 (SKP1)
09126 Chromosome
03083 Polycomb repressive complex
107125984 (SKP1)
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
107125984 (SKP1)
04350 TGF-beta signaling pathway
107125984 (SKP1)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
107125984 (SKP1)
04114 Oocyte meiosis
107125984 (SKP1)
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
107125984 (SKP1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
gja04131
]
107125984 (SKP1)
04121 Ubiquitin system [BR:
gja04121
]
107125984 (SKP1)
03036 Chromosome and associated proteins [BR:
gja03036
]
107125984 (SKP1)
Membrane trafficking [BR:
gja04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
107125984 (SKP1)
Ubiquitin system [BR:
gja04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
107125984 (SKP1)
Cul7 complex
107125984 (SKP1)
Chromosome and associated proteins [BR:
gja03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
107125984 (SKP1)
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
107125984 (SKP1)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
107125984
NCBI-ProteinID:
XP_015284959
UniProt:
A0ABM1LG72
LinkDB
All DBs
Position
Un
AA seq
163 aa
AA seq
DB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgccttcaattaaactgcagagttctgatggagagatatttgaggttgatgttgaaatt
gcaaagcagtctgtaacaatcaagactatgttggaagatttaggaatggatgatgaaggg
gatgatgatcctgttcctcttccaaatgttaatgcagctatattaaaaaaggtgatccag
tggtgtacccaccataaagatgacccaccacctcctgaggatgatgagaacaaagagaaa
cgaacagatgacatccctgtttgggaccaagaatttcttaaagtagatcaaggaactctc
tttgaacttatcctggctgccaactacttagacatcaaaggtttacttgatgtgacatgc
aaaactgttgcaaatatgattaaggggaaaacaccagaagaaatccgcaagactttcaat
atcaagaatgacttcactgaagaggaagaagctcaggtacgcaaagagaaccagtggtgt
gaagagaagtga
DBGET
integrated database retrieval system