Geobacillus genomosp. 3: M493_03060 Help Entry M493_03060        CDS       T02798                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism gjf  Geobacillus genomosp. 3 Pathway gjf03060   Protein export gjf03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:gjf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     M493_03060  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     M493_03060  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:gjf02044]     M493_03060 Secretion system [BR:gjf02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    M493_03060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AGT30920 UniProt:  S5Z9T8 LinkDB All DBs Position complement(513449..513652) Genome browser AA seq 67 aa AA seqDB search MLQNIGIPGLILILVIALIIFGPSKLPEIGRAFGTTLKEFKKSTRELVADDEPNKTLPTN NKVEKTS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgttgcaaaacataggaattccaggactaatccttattttagtcatcgccttaatcatc ttcgggccgtccaaacttcccgaaattgggcgcgcttttggcacaacattaaaagagttc aaaaaatcgacgcgggaattggtcgcagacgatgagccgaacaaaacgttgccaaccaat aataaagtagaaaaaacgagctag

DBGET integrated database retrieval system