Geobacillus genomosp. 3: M493_05155 Help Entry M493_05155        CDS       T02798                                  Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism gjf  Geobacillus genomosp. 3 Pathway gjf02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:gjf00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     M493_05155  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:gjf02000]     M493_05155 Transporters [BR:gjf02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     M493_05155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr DUF2218 Motif Other DBs NCBI-ProteinID:  AGT31330 UniProt:  S5ZB43 LinkDB All DBs Position 911074..911340 Genome browser AA seq 88 aa AA seqDB search MAEKTFTVTSDSGIHARPATILVQTASKFNSEIQLEYNDKTVNLKSIMGVMSLGIPKGAT IKITAEGADAAEAMAALTDTLAKEGLAE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaaaacgtttacagtgacttcagactccggcattcatgcccgcccggcgacg attttggtgcaaacggcgagcaagtttaacagcgaaattcagctcgagtacaacgacaaa acggtgaatttaaagtcgatcatgggcgtcatgtcgttaggcattccgaagggggccacg attaaaattacggcagaaggggccgatgcagcagaggcgatggcagcgttgacggacacg ttggcgaaagaaggccttgccgagtaa

DBGET integrated database retrieval system