Geobacillus genomosp. 3: M493_05585
Help
Entry
M493_05585 CDS
T02798
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
gjf
Geobacillus genomosp. 3
Pathway
gjf00770
Pantothenate and CoA biosynthesis
gjf01100
Metabolic pathways
gjf01240
Biosynthesis of cofactors
Module
gjf_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
gjf00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
M493_05585
Enzymes [BR:
gjf01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
M493_05585
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
OSCP
RGS
Motif
Other DBs
NCBI-ProteinID:
AGT31415
UniProt:
S5ZBC7
LinkDB
All DBs
Position
990860..991351
Genome browser
AA seq
163 aa
AA seq
DB search
MASIAVCPGSFDPVTYGHLDIIKRGAKVFDQVYVAVLNNSSKKPLFTVEERMELLREVTR
TLENVRVESFHGLLVDYARSKKANAILRGLRAVSDFEYEMQITSMNRVLDENIETFFMMT
NSQYAFLSSSIVKEVAKYNGDISELVPPIVEAALRQKFASAAD
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atggcgagcattgccgtttgcccagggagctttgaccctgtgacatacgggcatttggat
attattaaacggggagcgaaagtgtttgaccaagtttatgttgccgtgttaaacaattcg
tcaaaaaagccgctgtttaccgtcgaggagcggatggagttgctgcgcgaggtgacgcgg
acgctcgagaacgttcgtgttgaatcctttcacggcctgcttgtcgactatgcccgcagc
aaaaaggcgaacgccattttgcgcggtttgcgtgccgtgtccgattttgagtatgaaatg
caaattacgtcgatgaaccgcgtcctcgatgagaacatcgaaacattttttatgatgaca
aacagccaatatgcgtttttaagctctagcatcgtcaaagaagttgcgaaatataatggc
gatatttccgagctcgtccccccgatcgtggaagcggcgctaaggcagaagtttgcatct
gccgccgattaa
DBGET
integrated database retrieval system