KEGG   Geobacillus genomosp. 3: M493_05585
Entry
M493_05585        CDS       T02798                                 
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00770  Pantothenate and CoA biosynthesis
gjf01100  Metabolic pathways
gjf01240  Biosynthesis of cofactors
Module
gjf_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    M493_05585
Enzymes [BR:gjf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     M493_05585
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig OSCP RGS
Other DBs
NCBI-ProteinID: AGT31415
UniProt: S5ZBC7
LinkDB
Position
990860..991351
AA seq 163 aa
MASIAVCPGSFDPVTYGHLDIIKRGAKVFDQVYVAVLNNSSKKPLFTVEERMELLREVTR
TLENVRVESFHGLLVDYARSKKANAILRGLRAVSDFEYEMQITSMNRVLDENIETFFMMT
NSQYAFLSSSIVKEVAKYNGDISELVPPIVEAALRQKFASAAD
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcgagcattgccgtttgcccagggagctttgaccctgtgacatacgggcatttggat
attattaaacggggagcgaaagtgtttgaccaagtttatgttgccgtgttaaacaattcg
tcaaaaaagccgctgtttaccgtcgaggagcggatggagttgctgcgcgaggtgacgcgg
acgctcgagaacgttcgtgttgaatcctttcacggcctgcttgtcgactatgcccgcagc
aaaaaggcgaacgccattttgcgcggtttgcgtgccgtgtccgattttgagtatgaaatg
caaattacgtcgatgaaccgcgtcctcgatgagaacatcgaaacattttttatgatgaca
aacagccaatatgcgtttttaagctctagcatcgtcaaagaagttgcgaaatataatggc
gatatttccgagctcgtccccccgatcgtggaagcggcgctaaggcagaagtttgcatct
gccgccgattaa

DBGET integrated database retrieval system