Geobacillus genomosp. 3: M493_16295 Help Entry M493_16295        CDS       T02798                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism gjf  Geobacillus genomosp. 3 Pathway gjf02020   Two-component system gjf02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:gjf00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     M493_16295  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     M493_16295  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:gjf02035]     M493_16295 Bacterial motility proteins [BR:gjf02035]  Flagellar system   Flagellar assembly proteins    Others     M493_16295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Aquarius_N_2nd VirionAssem_T7 Motif Other DBs NCBI-ProteinID:  AGT33473 UniProt:  S5ZSK6 LinkDB All DBs Position complement(3011296..3011565) Genome browser AA seq 89 aa AA seqDB search MRIDHWFSLGVHPYRQSSGIAPGKTGQTGRRDRVEISEAAKELQQRPTWAAEREEKVRRL KAQLDSGTYEIDARAIAEKLYQFYKGDGR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt ttgagaatcgatcattggttttcgcttggcgttcatccgtaccgtcaatcttcggggatc gcgccaggaaaaacagggcaaacgggacggcgggatcgcgtcgagatttccgaggccgcc aaagagctgcagcaacgcccgacttgggccgccgagcgagaagagaaagtgcgccgattg aaagcacaacttgacagcgggacgtatgagatcgatgcgcgcgccattgcggaaaaacta taccagttttacaagggcgatggccgatga

DBGET integrated database retrieval system