Gordonia jinghuaiqii: H1R19_02595 Help Entry H1R19_02595       CDS       T07538                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gji  Gordonia jinghuaiqii Pathway gji01100   Metabolic pathways gji01110   Biosynthesis of secondary metabolites Module gji_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:gji00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H1R19_02595    00074 Mycolic acid biosynthesis     H1R19_02595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H1R19_02595 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QMT02089 UniProt:  A0A7D7QY24 LinkDB All DBs Position 597242..597496 Genome browser AA seq 84 aa AA seqDB search MSDNITEALRGILEEDLDLALGDISRDSQLIDDLGLDSVAFAIGVVAIEERLGVKLSERE LFESKTVGDLEDLIRSKADAATPR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaacatcaccgaagccctgcgcggcatcctcgaggaagacctcgacctcgcg ctcggtgacatcagccgcgactcccagctgatcgacgacctcggtctggactcggtggcg ttcgccatcggcgtggtggccatcgaagagcgtctcggcgtgaagctgtccgagcgcgag ctcttcgagtccaagacggtcggcgatctcgaggatctgatccggtcgaaggccgacgca gcaactcccagatga

DBGET integrated database retrieval system