Gilvimarinus japonicus: R50076_28050 Help Entry R50076_28050      CDS       T10758                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gjp  Gilvimarinus japonicus Pathway gjp01100   Metabolic pathways gjp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gjp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R50076_28050    00074 Mycolic acid biosynthesis     R50076_28050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R50076_28050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BFM21756 LinkDB All DBs Position complement(3318954..3319202) Genome browser AA seq 82 aa AA seqDB search MTKDEIYSELKAVLVQSFMIDEGDISLDADLYTDLDFDSIDAIDLAAKIHSVTGKQLKPE QFKGVRTIGDAVNVVDELMRNG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactaaagacgaaatatattcagagctaaaagcggttctggttcaatcttttatgatc gacgaaggcgacatctctttggacgccgatctgtatactgatttggactttgacagtatt gatgctatcgacctagcggcaaaaatccatagtgttaccggtaagcagttaaagcccgag cagtttaaaggggttcgcaccattggcgatgcggttaatgttgtcgatgagcttatgaga aacggttga

DBGET integrated database retrieval system