Geobacillus kaustophilus: GK1515 Help Entry GK1515            CDS       T00217                                  Name (GenBank) hypothetical conserved protein   KO K03116   sec-independent protein translocase protein TatA Organism gka  Geobacillus kaustophilus Pathway gka03060   Protein export gka03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:gka00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GK1515  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GK1515  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:gka02044]     GK1515 Secretion system [BR:gka02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GK1515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BAD75800 UniProt:  Q5KZT6 LinkDB All DBs Position 1553590..1553760 Genome browser AA seq 56 aa AA seqDB search MNIGFGEIALIVFFALLIFGPKKLPELGQAAGKTLREFKNATKGIIDDDETTKAQK NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgaacatcggctttggagaaattgcgctcatcgtctttttcgctttgctcattttcggg ccgaaaaagctgccggagttaggacaagcggccgggaaaacgctgcgcgaatttaagaat gcgacaaaaggcatcatcgacgatgacgagacgacaaaagcgcaaaaataa

DBGET integrated database retrieval system