Geobacillus kaustophilus: GK2075 Help Entry GK2075            CDS       T00217                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism gka  Geobacillus kaustophilus Brite KEGG Orthology (KO) [BR:gka00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gka03110]     GK2075 Chaperones and folding catalysts [BR:gka03110]  Protein folding catalysts   Protein disulfide isomerase    GK2075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 GST_N IU_nuc_hydro Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  BAD76360 UniProt:  Q5KY76 LinkDB All DBs Position complement(2115631..2115876) Genome browser AA seq 81 aa AA seqDB search MAQVTVYTTTTCPYCVMAKNFLRAQGIPFKEVNVEFDPEAARRLVETTGQMGVPQIEIGG RWVLGYDPDAIMALWNQTNHR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcacaagttactgtttatactacaacgacgtgcccgtactgcgtcatggcgaaaaac tttttgcgcgctcaagggattccgtttaaagaagtgaatgtcgaattcgacccggaagca gcgcgcagactggtggaaacgacggggcaaatgggcgtgccccaaatcgaaatcggtggc cgttgggtgctcgggtatgatccagatgccattatggcattgtggaatcagacgaatcat cgttga

DBGET integrated database retrieval system