KEGG   Grimontia kaedaensis: K6Q96_05050
Entry
K6Q96_05050       CDS       T09175                                 
Name
(GenBank) ATP-dependent DNA helicase
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
gkd  Grimontia kaedaensis
Brite
KEGG Orthology (KO) [BR:gkd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gkd03400]
    K6Q96_05050
Enzymes [BR:gkd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     K6Q96_05050
DNA repair and recombination proteins [BR:gkd03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    K6Q96_05050
SSDB
Motif
Pfam: Helicase_C_2 DEAD ResIII DEAD_2 T4SS-DNA_transf POTRA_2
Other DBs
NCBI-ProteinID: USH03385
UniProt: A0ABY4WW03
LinkDB
Position
I:1057373..1059328
AA seq 651 aa
MISKVFSTTGALARAIKGFQPRQPQTDMALSVERSIKNQTQLVVEAGTGTGKTYAYLVPA
LLSGKKTIVSTGSKNLQEQLFHRDLPLMVDTLGFSGRVALLKGRANYLCPERLSRQMIES
HDGHADPTLLSQLVKVRSWSSETKTGDLGECDDLAEDSPIIPTITSTNDNCLGKECPSYE
DCFVVKARKRAMDADLVVVNHHLFLADLAIKETGFGELIPEAEVFIFDEAHQIPDIASQY
FGQSLSSRQLQELAKDINIAYRTELRDTKQLEKVADRLSQSASDLRIVLGEPGFRGNWRE
ISTSPAVARELVRLTDALELAHDVMKLSLGRSQLLDAAFDRATLFKARLERVKDTSIPGY
SYWYECSRHHFSLNITPLSVAEKFREQIQQQEGAWIFTSATLAVNDDFSHFSNRLGLEPT
EQFTLPSPFDYESQAILCVPRFLPEPNSYGLADKLVDMLKPVIEQNNGRCFFLCTSHQMV
RDLSERFRELSDLPVLVQGEMSKQKLLAEFLELGNALLVATGAFWEGIDVRGQALSCVII
DKLPFTAPDDPLLKARIEDCRLQGGDPFSQVQIPDAVITLKQGVGRLIRDRNDHGALIIC
DNRLVSRNYGETFLRSLPPIPRTRDLAKVSEFLAEIDTNNQSAESSAASEV
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgatttcgaaggttttctccaccacaggtgcgttggctcgagcgataaaaggtttccag
ccacgccagccgcagaccgatatggcgttgtcagttgagcgttcaatcaaaaaccaaact
caactcgtagtcgaggcagggacgggtaccggtaaaacatatgcgtatctggtgcctgca
ctgcttagtggaaagaaaaccattgtcagtacaggttcgaaaaatcttcaggaacagctg
tttcaccgtgatctaccattgatggtcgacaccctcggcttctcaggtcgtgttgccttg
ctgaaagggcgagcaaactacctttgcccagaacgcttgagtcgccagatgatcgagagt
cacgacggtcacgctgatccgacactgcttagccagttagtgaaagtacgcagctggtct
tcagaaaccaaaaccggtgatctgggcgagtgcgatgatttggcggaagacagcccaatc
atccccacaattacctcgacgaatgacaactgtctgggcaaggaatgcccaagctatgaa
gactgttttgtggtgaaggcccgcaaacgcgccatggatgcagacttggtggtcgtgaat
caccaccttttcctagccgatttggcgatcaaagaaacagggtttggtgaactgattccg
gaagcggaagtgtttatcttcgatgaagcgcaccagatccccgatatcgccagccagtat
ttcggccagagtctttccagtcgtcagcttcaggaactcgccaaagacatcaacattgcg
tatcgcactgaacttcgcgataccaaacagcttgagaaagtcgctgatcgcctttctcaa
tcggcatcggatttgcgcattgtactgggcgagccgggctttcgtggtaactggcgtgaa
ataagcacttctccggcggtagcaagggagctggtgcgtttgaccgacgcactagagctt
gcccatgacgtgatgaagctgtcattgggtcgaagccagttgttggatgccgccttcgat
cgcgctactttatttaaagccagacttgagcgggtaaaagatacctctatccctggctat
tcctattggtacgaatgtagccgccatcatttcagcctgaacatcacaccattgtccgtg
gctgaaaaattccgcgagcaaattcagcagcaggaaggggcgtggatatttacctctgca
acgctcgcggtgaacgatgacttcagtcacttcagcaaccgcttgggtttagagcccaca
gagcagtttaccctgcctagtccattcgattacgaatctcaggcgattctctgtgttccg
cgctttttgccagagccaaacagctatggcttggctgacaagctggtggacatgcttaag
ccagtgattgagcaaaacaacggacgctgtttcttcctttgtacctcacatcaaatggtg
cgtgatttgtctgagcgtttccgcgaattgtcagacttgcctgtgttagtgcaaggggaa
atgtcgaaacaaaaactgctcgctgaatttttagagttgggtaatgcgcttttggttgcc
acaggtgccttctgggaagggatagacgttagagggcaggcgctgagctgtgttattatc
gacaaattgccttttactgcgccggacgatccgctgctaaaagcacggattgaagattgt
cgccttcagggcggcgacccgttttcccaggttcaaatccctgatgcagtgatcaccctc
aagcagggagttggtcgactcatccgtgatagaaacgatcatggtgcgcttattatctgt
gataaccgcttggtgagcagaaattatggtgaaaccttcctgcgcagcttaccgccaatc
ccgcgaacgcgtgatctggcaaaagtcagcgaatttctcgctgaaatagatacgaacaac
cagtctgcagaatcgtctgcagcgtcagaggtataa

DBGET integrated database retrieval system