Gallaecimonas kandeliae: PVT67_09840 Help Entry PVT67_09840       CDS       T09225                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gkn  Gallaecimonas kandeliae Pathway gkn01100   Metabolic pathways gkn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gkn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PVT67_09840    00074 Mycolic acid biosynthesis     PVT67_09840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PVT67_09840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD PP-binding_2 Motif Other DBs NCBI-ProteinID:  WKE64000 LinkDB All DBs Position complement(2011781..2012029) Genome browser AA seq 82 aa AA seqDB search MTRDQVFAELKTILVEDFEVEASNVTPDAHLYSDLDLDSIDAVDLVVKLQDLTGKKIQPE QFKAVRTVQDVVDAVLSLVAAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgcgcgaccaggtttttgccgaactcaagaccattctggtggaagacttcgaggtg gaggccagcaatgtcacccccgacgcccacctctacagcgacctggatctcgactccatc gacgccgtcgacctggtggtcaagctccaggatctgaccggcaagaagatccagcccgag cagttcaaggccgtgcgcaccgtacaagacgtggtagacgccgtgctgagcctggtggcc gccgcttga

DBGET integrated database retrieval system