Giardia lamblia: GL50803_0015144 Help Entry GL50803_0015144   CDS       T01047                                  Name (RefSeq) RNA polymerase II subunit Rpb8   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism gla  Giardia lamblia Pathway gla03020   RNA polymerase gla03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gla00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GL50803_0015144   09124 Replication and repair    03420 Nucleotide excision repair     GL50803_0015144  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:gla03021]     GL50803_0015144    03400 DNA repair and recombination proteins [BR:gla03400]     GL50803_0015144 Transcription machinery [BR:gla03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GL50803_0015144   RNA polymerase III system    RNA polymerase III      GL50803_0015144   RNA polymerase I system    RNA polymerase I      GL50803_0015144 DNA repair and recombination proteins [BR:gla03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GL50803_0015144 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Myosin_TH1 Motif Other DBs NCBI-GeneID:  5699264 NCBI-ProteinID:  XP_001706376 UniProt:  E2RU32 Q8MUU6 LinkDB All DBs Position 1:899166..899618 Genome browser AA seq 150 aa AA seqDB search MSLYSSRFSIASFDPECVKYYDNIGRVLLESTDDPDVFLTLDYNLELYPKLNKNARSLEV QILSSISYQDFNVSADSPNYDPKLSEILHDAYPDLDYAMHGTVFEFRAVGDKVDMFISFG GLIAKLQAPAFRLERFKFGMKLYLLCCNTM NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtctttgtacagtagccggtttagcattgcgtccttcgaccccgagtgcgtcaaatac tacgacaatataggaagggtgctactagagtccactgatgaccctgatgtttttctgacc ctcgattacaatctcgagctttatcccaagttgaacaaaaacgcgcggtcactggaggtg cagatactctccagtatctcatatcaggacttcaatgttagtgcagactctcctaactat gacccaaaactctccgagatccttcacgacgcctacccagacttagattatgctatgcac ggcactgtatttgagtttcgcgccgttggcgataaagtcgacatgttcatatcttttggg gggctcatcgccaagctccaggcgccagcattcaggcttgagcgcttcaagttcggcatg aagctctatctattgtgctgcaatactatgtga

DBGET integrated database retrieval system