Giardia lamblia: GL50803_009848 Help Entry GL50803_009848    CDS       T01047                                  Name (RefSeq) Dynein light chain LC8   KO K10418   dynein light chain LC8-type Organism gla  Giardia lamblia Pathway gla04517   IgSF CAM signaling gla04814   Motor proteins Brite KEGG Orthology (KO) [BR:gla00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     GL50803_009848  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     GL50803_009848  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gla03037]     GL50803_009848    04812 Cytoskeleton proteins [BR:gla04812]     GL50803_009848 Cilium and associated proteins [BR:gla03037]  Motile cilia and associated proteins   Dynein arm    GL50803_009848 Cytoskeleton proteins [BR:gla04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      GL50803_009848 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin Motif Other DBs NCBI-GeneID:  5699317 NCBI-ProteinID:  XP_001706428 UniProt:  A8BL61 LinkDB All DBs Position 1:complement(<805020..>805289) Genome browser AA seq 89 aa AA seqDB search MSERSVNVKNADMPEDMQQDAIDCAIQSMERFNIEKDIAAYIKKEFDKKHHPTWHVIVGK NFGSYITHETKRFIYFYVGQLAFLIFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgagcgcagcgttaacgtcaagaatgcagacatgcccgaggacatgcagcaggac gcgatagactgcgccatccagtccatggagcgcttcaacatcgagaaggacatcgcggcg tacataaagaaggagttcgacaagaagcaccacccgacctggcacgtcatagtcgggaag aacttcgggtcctacatcacgcatgagacaaagaggttcatctacttctacgtcggccag ctggccttcctgatcttcaagtctggttga

DBGET integrated database retrieval system