Glaciimonas sp. PAMC28666: JQN73_18330 Help Entry JQN73_18330       CDS       T07066                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism glc  Glaciimonas sp. PAMC28666 Brite KEGG Orthology (KO) [BR:glc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:glc03032]     JQN73_18330    03036 Chromosome and associated proteins [BR:glc03036]     JQN73_18330    03400 DNA repair and recombination proteins [BR:glc03400]     JQN73_18330 DNA replication proteins [BR:glc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JQN73_18330 Chromosome and associated proteins [BR:glc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JQN73_18330 DNA repair and recombination proteins [BR:glc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JQN73_18330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QRX82050 LinkDB All DBs Position 4312110..4312400 Genome browser AA seq 96 aa AA seqDB search MNKNELIEGIAADCELSKAAAKRAVDSLIANVIKAVKKGDSVQLIGFGTFGSGKRAARVG RNPRTGEAIKIKAATTVKFTAGKAFKDAVNGAKKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaataaaaatgaattgattgaaggtattgctgcagattgtgaactgtcaaaagcagcc gctaaacgtgctgtcgactctttgattgcaaatgtcatcaaagcagttaagaagggcgat tccgtccaattgatcggatttggtactttcggtagcggtaaacgcgccgctcgggttgga cgtaatccacgtactggcgaagcaatcaaaattaaagcagcaacaacggtcaaattcacc gccggcaaagcatttaaagatgctgtaaatggcgcaaaaaagaagaagtaa

DBGET integrated database retrieval system