Glaesserella sp. 15-184: CJD39_10710 Help Entry CJD39_10710       CDS       T05643                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gle  Glaesserella sp. 15-184 Pathway gle01100   Metabolic pathways gle01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gle00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJD39_10710    00074 Mycolic acid biosynthesis     CJD39_10710   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJD39_10710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  AUI67011 LinkDB All DBs Position 2232026..2232256 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVDQLGAKAEDVKPEASFIEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaattatcgttgatcaacttggtgcaaaagcagaa gacgttaaaccagaagcttctttcatcgaagatttaggtgcagactctcttgacactgtt gagttagtgatggctttagaagaagaattcgatatcgaaattccagatgaagaagcagaa aaaatcactactgttcaatctgcgattgattacgttcaaaacaatcaataa

DBGET integrated database retrieval system